KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100403864Help
Entry
100403864         CDS       T03264                                 

Gene name
CPT1B
Definition
(RefSeq) carnitine palmitoyltransferase 1B
  KO
K19523  carnitine O-palmitoyltransferase 1, muscle isoform [EC:2.3.1.21]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00071  Fatty acid degradation
cjc01212  Fatty acid metabolism
cjc03320  PPAR signaling pathway
cjc04152  AMPK signaling pathway
cjc04714  Thermogenesis
cjc04920  Adipocytokine signaling pathway
cjc04922  Glucagon signaling pathway
cjc04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    100403864 (CPT1B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    100403864 (CPT1B)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100403864 (CPT1B)
   04920 Adipocytokine signaling pathway
    100403864 (CPT1B)
   03320 PPAR signaling pathway
    100403864 (CPT1B)
  09159 Environmental adaptation
   04714 Thermogenesis
    100403864 (CPT1B)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100403864 (CPT1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cjc03029]
    100403864 (CPT1B)
Enzymes [BR:cjc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     100403864 (CPT1B)
Mitochondrial biogenesis [BR:cjc03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    100403864 (CPT1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N DUF3128
Motif
Other DBs
NCBI-GeneID: 100403864
NCBI-ProteinID: XP_008979036
Ensembl: ENSCJAG00000018317
UniProt: U3EYN6
Position
1
AA seq 772 aa AA seqDB search
MAEAHQAVAFQFTVTPEGVDFRLSREALKHIYLSGINSWKKRLIRIKNGILRGVYPGSPT
SWLVVVMATVGSSYCNLDISLGLVGCIQRCLPRGCEPYQTPQTRELLSMAIFSTGVWATG
IFFFRQTLKLLLSYHGWMFEMHGKTSHLTRIWAICIRLLSSRRPMLYSFQTSLPKLPVPR
VSATIQRYLESVRPLLDDEEYYRMEMLAEEFKEKTAPRLQKYLVLKSWWATNYVSDWWEE
YIYLRGRSPLMVNSNYYVMDLVLIRNTDVQAARLGNIIHAMIMYRRKLDREEIKPVMALG
MVPMCSYQMERMFNTTRIPGKETDTLQHLSDSRHVAVYHKGRFFKLWLYEGSRLLQPRDL
QMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAALEAIERAAFFVA
LDEESYWYDPEDEASLSLYGKALLHGNCYNRWFDKSFTLISFKNGQLGLNAEHAWADAPI
IGHLWEFVLGTDSFHLGYTETGHCLGKPNPALAPPMRLQWDIPKQCQAVIENSYQVAKAL
ADDVELYCFQFLPFGKGLIKRCRTSPDAFVQIALQLAHFRDRGKFCLTYEASMTRMFREG
RTETVRSCTSESTAFVQAMMEGSHVKADLRDLFQKASKKHQNMYRLAMTGAGIDRHLFCL
YLVSKYLGVSSPFLAEVLSEPWRLSTSQIPQSQIRMFDPDQHPNHLGAGGGFGPVADDGY
GVSYMIAGENMIFFHVSSKFSSSETNAQRFGNHIRQALLDIADLFQVPKADS
NT seq 2319 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagcgcaccaggccgtggccttccagttcacggtgaccccagaaggggtcgac
ttccggctcagtcgggaggccctgaaacacatctacctgtctggaatcaactcctggaag
aaacgcctgatccgcatcaagaatggcatcctcaggggcgtgtaccctggcagccccacc
agctggctggtcgtcgtcatggcaacagtgggttcctcctactgcaacttggacatctcc
ttggggctggtcggttgcatccagagatgcctccctcgggggtgtgagccctaccagaca
ccgcagacccgggaacttcttagcatggccatcttctccacgggcgtctgggcaacaggc
atcttcttcttccgccaaactctgaagctgctgctttcctaccatgggtggatgtttgag
atgcatggcaagaccagccacttgaccaggatctgggctatatgtatccgccttctatcc
agtcggcgccccatgctctacagcttccagacgtctctgcccaagcttcctgtgcccagg
gtgtcagccacaattcagcggtacctagagtctgtgaggcccttgttggatgatgaggaa
tattaccgcatggagatgctggctgaagaattcaaggagaagactgcccccaggctgcag
aaatatctggtgctcaagtcatggtgggcaactaactatgtgagtgactggtgggaagag
tacatttaccttcgaggcaggagccctctcatggtgaacagcaactattatgtcatggac
cttgtgctcatcaggaatacagacgtgcaggcagcccgtctgggaaacatcatccatgcc
atgatcatgtatcgccgtaaactggaccgtgaagaaatcaagcctgtgatggcactgggc
atggtgcccatgtgctcctaccagatggagaggatgttcaacaccactcggatcccgggc
aaggagacagatacgctacaacacctctcggacagccggcacgtggctgtctaccacaaa
ggacgcttcttcaagctgtggctctatgagggctcccgtctgctccagcctcgggatctg
cagatgcaattccagagaatcctggacgacccctccccgcctcagcctggggaggagaag
ctggcagccctcactgcaggaggaagggtggagtgggcgcaggcacgccaggccttcttc
agctccggaaagaacaaggctgccttggaggccatcgagcgtgccgctttctttgtggcc
ctggatgaggagtcctactggtacgaccccgaagatgaggccagcctcagcctctatggc
aaggccctgctacatggcaactgctacaacaggtggtttgacaaatccttcactctcatt
tccttcaagaatggccagttgggtctcaatgcagaacatgcgtgggcagacgctcccatc
attgggcacctctgggagtttgtcctgggcacagacagcttccacctgggctacacagag
actgggcactgcctgggcaaaccaaaccctgctctggcacctcctatgcgactgcagtgg
gacattccaaaacagtgccaggcagtcatcgagaattcctaccaggtggccaaggcactg
gcagacgatgtggagttgtactgcttccagtttctgccctttggcaaaggcctcatcaag
aggtgccggaccagcccggatgcctttgtgcagattgcactgcagctggctcacttccgg
gacaggggtaagttctgcctgacctatgaggcctcaatgaccagaatgttccgggaggga
cggactgagactgtgcgttcctgtaccagtgagtccacagcctttgtgcaggccatgatg
gaggggtcccacgtgaaagcagacctgcgagatctcttccagaaagcttctaagaagcac
cagaatatgtaccgcctggccatgacaggggcagggatcgacaggcacctcttctgcctt
tacttggtctccaagtacctgggagtcagctctcctttcctggctgaggtgctctcggaa
ccctggcgcctctccaccagccagatccctcaatcccagatccgcatgttcgatccagac
cagcaccccaaccacctgggtgctggaggtggctttggccctgtagcagatgatggctat
ggggtttcctacatgattgcaggcgagaacatgatcttcttccatgtctccagcaagttc
tcaagctcagagacgaatgcccagcgctttgggaaccacatccgccaagccctactggac
atcgctgatcttttccaagttcccaaggctgacagctga

DBGET integrated database retrieval system