KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100403944Help
Entry
100403944         CDS       T03264                                 

Gene name
CD3E
Definition
(RefSeq) CD3e molecule
  KO
K06451  T-cell surface glycoprotein CD3 epsilon chain
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04640  Hematopoietic cell lineage
cjc04658  Th1 and Th2 cell differentiation
cjc04659  Th17 cell differentiation
cjc04660  T cell receptor signaling pathway
cjc05142  Chagas disease (American trypanosomiasis)
cjc05162  Measles
cjc05166  Human T-cell leukemia virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cjc05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100403944 (CD3E)
   04660 T cell receptor signaling pathway
    100403944 (CD3E)
   04658 Th1 and Th2 cell differentiation
    100403944 (CD3E)
   04659 Th17 cell differentiation
    100403944 (CD3E)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100403944 (CD3E)
  09163 Immune disease
   05340 Primary immunodeficiency
    100403944 (CD3E)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100403944 (CD3E)
   05170 Human immunodeficiency virus 1 infection
    100403944 (CD3E)
   05162 Measles
    100403944 (CD3E)
   05169 Epstein-Barr virus infection
    100403944 (CD3E)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    100403944 (CD3E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:cjc04090]
    100403944 (CD3E)
CD molecules [BR:cjc04090]
 Proteins
  100403944 (CD3E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_5 Ig_4 ITAM P5-ATPase Ig_3
Motif
Other DBs
NCBI-GeneID: 100403944
NCBI-ProteinID: NP_001244149
Ensembl: ENSCJAG00000013183
UniProt: Q3LRP4
Position
11
AA seq 198 aa AA seqDB search
MQSGTRWRVLGLCLLSVGIWGQDGNEEMGDTTQNPYKVSISGTTVTLTCPRYDGHEIKWL
VNSQNKEGHEDHLLLEDFSEMEQSGYYACLSKETPAEEASHYLYLKARVCENCVEVDVMA
VATIVIVDICITLGLLLLVYYWSKNRKAKAKPVTRGVGAGGRQRGQNKERPPPVPNPDYE
PIRKGQRDLYSGLNQRGI
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcagtcaggcactcgctggagagttctgggcctctgcctcttatcagttggcatctgg
gggcaggacggtaatgaagaaatgggtgatactacacagaacccatataaagtttccatc
tcaggaaccacagtaacactgacatgccctcggtatgatggacatgaaataaaatggctc
gtaaatagtcaaaacaaagaaggtcatgaggaccacctgttactggaggacttttcggaa
atggagcaaagtggttattatgcctgcctctccaaagagactcccgcagaagaggcgagc
cattatctctacctgaaggcaagagtgtgtgagaactgcgtggaggtggatgtgatggcg
gtggccacaattgtcatagtggacatctgcatcactctgggcttgctgctgctggtttac
tactggagcaagaatagaaaggccaaggccaagcccgtgacacgaggagtgggtgctggt
ggcaggcaaaggggacaaaacaaggagaggccaccacctgttcccaacccagactatgag
cccatccggaaaggccagcgggacctgtattctggcctgaatcagagaggcatctga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100404313Help
Entry
100404313         CDS       T03264                                 

Gene name
CD3D
Definition
(RefSeq) CD3d molecule
  KO
K06450  T-cell surface glycoprotein CD3 delta chain
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04640  Hematopoietic cell lineage
cjc04658  Th1 and Th2 cell differentiation
cjc04659  Th17 cell differentiation
cjc04660  T cell receptor signaling pathway
cjc05142  Chagas disease (American trypanosomiasis)
cjc05162  Measles
cjc05166  Human T-cell leukemia virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cjc05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100404313 (CD3D)
   04660 T cell receptor signaling pathway
    100404313 (CD3D)
   04658 Th1 and Th2 cell differentiation
    100404313 (CD3D)
   04659 Th17 cell differentiation
    100404313 (CD3D)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100404313 (CD3D)
  09163 Immune disease
   05340 Primary immunodeficiency
    100404313 (CD3D)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100404313 (CD3D)
   05170 Human immunodeficiency virus 1 infection
    100404313 (CD3D)
   05162 Measles
    100404313 (CD3D)
   05169 Epstein-Barr virus infection
    100404313 (CD3D)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    100404313 (CD3D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:cjc04090]
    100404313 (CD3D)
CD molecules [BR:cjc04090]
 Proteins
  100404313 (CD3D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_4 ITAM Ig_5
Motif
Other DBs
NCBI-GeneID: 100404313
NCBI-ProteinID: XP_002754528
Ensembl: ENSCJAG00000013205
UniProt: F7FPX1
Position
11
AA seq 171 aa AA seqDB search
MEHSMFLSGLVLVTLLPQVSPFKIPVEELEDRVFVSCNTSITWVEGTVGTLLTNNTRLDL
GKGILDPRGMYQCTGTEKYAGQVSTVQVYYRMCQSCVELYPATLAGIIVTDVIATVLLAL
GVYCFAGHETGRLSGVADTQALLRNDQVYQPLRDRDDAQYSRLGGNWPRNK
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atggaacatagcatgtttctgtctggcctggtactggttacccttctcccccaagtgagc
cccttcaagatacctgtagaggaacttgaggacagagtgtttgtgagttgtaataccagc
atcacatgggtagagggaacagtgggaacactgctcacaaacaatacaaggctggacctg
ggaaaaggcatcctggacccacgaggaatgtatcagtgtactgggacagaaaaatacgcc
ggccaagtatctactgtgcaagtttattatcgaatgtgccagagctgtgtggagctgtat
ccagccaccctggctggcatcattgtcactgatgtcattgccactgtactcctcgctttg
ggagtctactgctttgctggacatgagactggaaggctctctggggtggctgacacacaa
gctctgctgaggaatgaccaggtctatcagcccctccgagatcgagatgatgctcagtat
agccgccttggaggaaactggccccggaacaagtga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100404679Help
Entry
100404679         CDS       T03264                                 

Gene name
CD3G
Definition
(RefSeq) CD3g molecule
  KO
K06452  T-cell surface glycoprotein CD3 gamma chain
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04640  Hematopoietic cell lineage
cjc04658  Th1 and Th2 cell differentiation
cjc04659  Th17 cell differentiation
cjc04660  T cell receptor signaling pathway
cjc05142  Chagas disease (American trypanosomiasis)
cjc05162  Measles
cjc05166  Human T-cell leukemia virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100404679 (CD3G)
   04660 T cell receptor signaling pathway
    100404679 (CD3G)
   04658 Th1 and Th2 cell differentiation
    100404679 (CD3G)
   04659 Th17 cell differentiation
    100404679 (CD3G)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100404679 (CD3G)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100404679 (CD3G)
   05170 Human immunodeficiency virus 1 infection
    100404679 (CD3G)
   05162 Measles
    100404679 (CD3G)
   05169 Epstein-Barr virus infection
    100404679 (CD3G)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    100404679 (CD3G)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:cjc04090]
    100404679 (CD3G)
CD molecules [BR:cjc04090]
 Proteins
  100404679 (CD3G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_4 Ig_5 ITAM Ig_2 Ig_3 I-set
Motif
Other DBs
NCBI-GeneID: 100404679
NCBI-ProteinID: XP_002754529
Ensembl: ENSCJAG00000013216
UniProt: A0A2R8MU93
Position
11
AA seq 210 aa AA seqDB search
MGGASLAAAQADWLLRAAPRFCQRTETDMEQGKGLAGLILAITLLQGTLVQSNKGKLLLT
VEDRQEDGSVLLTCEVQGKNITWFKDGKIISFLPASQKTWNLGSNTKDPRGMYQCKGSKD
KSKPLQLYYRMCQNCIELSAATISGFVFAEIISIFFLAVGVYFIAGQDGVHQSRASDKQT
LLPNDQLYQPLKDREDDQYSHLQGNQLRRN
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgggtggagccagtctagccgctgcacaggctgactggctgctaagggctgctccacgc
ttttgccagaggacagagactgacatggaacaggggaagggcctggctggcctcattctg
gctatcactcttcttcaaggtactctggtccagtcaaacaaaggaaaactcttgctcacg
gtggaggaccgtcaagaagatggttcagtacttctgacttgtgaggtgcaaggcaaaaat
atcacatggtttaaagatgggaagataataagcttcctacctgcaagtcaaaaaacatgg
aatctgggaagtaataccaaggaccctcgagggatgtatcaatgtaaaggatcaaaggac
aagtcaaaaccactgcaactgtattatagaatgtgtcagaactgcatcgaactaagtgca
gccaccatatctggctttgtctttgctgaaatcatcagcattttcttccttgctgttggg
gtctacttcattgctggacaggatggagttcaccagtcaagagcttccgacaaacagact
ctgttgcccaatgaccagctctaccagcccctcaaggatcgagaagatgaccagtatagc
caccttcaaggaaaccaactgaggaggaattga

DBGET integrated database retrieval system