KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100403983Help
Entry
100403983         CDS       T03264                                 

Gene name
MAD1L1
Definition
(RefSeq) MAD1 mitotic arrest deficient like 1
  KO
K06679  mitotic spindle assembly checkpoint protein MAD1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04110  Cell cycle
cjc04114  Oocyte meiosis
cjc04914  Progesterone-mediated oocyte maturation
cjc05166  Human T-cell leukemia virus 1 infection
cjc05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100403983 (MAD1L1)
   04114 Oocyte meiosis
    100403983 (MAD1L1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100403983 (MAD1L1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100403983 (MAD1L1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100403983 (MAD1L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cjc03036]
    100403983 (MAD1L1)
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Core SAC proteins
     100403983 (MAD1L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAD TSC22 DUF4200 DUF2856
Motif
Other DBs
NCBI-GeneID: 100403983
NCBI-ProteinID: XP_008987188
Ensembl: ENSCJAG00000001463
Position
2
AA seq 718 aa AA seqDB search
MEDLGENTTVLSTLRSLNNFISQRVEGGSGLDIPTSAPGSLQMQYQQSMQVEERAEQIRS
KSHLIQVEREKMQMELSHKRARVELERAASTSARNYEREVDRNQELLTRIRQLQEREAGA
EEKMQEQLERSRQCQQNLDATSKRLREKEDSLAQAGETINTLKGRISELQWNVMDQEMRV
KRLESEKQELQEQLDLQHKKWQEASQKIQELQASQETRADQEQQIKDLEQKLSLQEQDAA
IVKNMKSELVRLPRLERELKQLREESARLREMRETNGLLQEEVEGLQRKLGRQEKMQETL
VGLELDNEKLLARLQSWERLEQTMGLNVRTPEDLSRFVVELQQRELALKDKNSAITSSAR
GLEKARQQLQEELRQVNGQLLEERKKRETHEALARRLQKRVLLLTKERDGMRAILGSYDS
ELTPAEYSPQLTRRMREAEDMVQKVHSHSAEMEAQLSQALEELGGQKQRADMLEMELKML
KSQSSSPEQSFLFSREEVDMLRLKVEELEGERSRLEEEKRMLEAQLERLTLQGDYDQSKT
KVLHMSLNPASVARQRLREDHNQLQAECERLRGLLHTMEKGGTVPADLEAAAASLPSSKE
VAELRKQVESAELKNQRLKEVFQTKIQEFRKACYTLTGYQIDITTENQYRLTSLYAEHQG
DCLIFKATGPSGSKMQLLETEFSRTVGELIEVHLRRQDSIPAFLSSLTLELFSRQTMT
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atggaagacctaggggaaaacaccacggttttatccaccctgagatctttgaacaacttc
atctctcagcgtgtggagggaggatctggactggatattcccacctcggccccaggttct
ctgcagatgcagtaccagcagagcatgcaggtggaggaaagagcagagcagatccgttcc
aagtcccacctcatccaggtggagcgggagaagatgcagatggagctgagtcacaagagg
gctcgagtggagctggagagagcggccagcaccagtgccaggaactatgagcgcgaggtt
gaccgcaaccaggagctcctgacgcgcatccggcagcttcaggagcgtgaggctggtgcg
gaggagaagatgcaggagcagctggagcgcagtaggcagtgtcagcagaacctggacgct
accagcaagagactgcgtgagaaagaggacagcctggctcaggctggcgagaccatcaac
acattgaaggggaggatctcggaactgcagtggaacgtgatggatcaggagatgcgggtg
aagcgtctggagtcagagaagcaggagctgcaggagcagctggacctgcagcacaaaaaa
tggcaggaagccagtcagaaaatccaggaactccaggccagccaagaaacgagagcagat
caagagcagcagattaaggatctggagcagaagctgtccctacaagagcaggatgctgct
attgtgaagaacatgaagtctgagctggtgcgactccctaggctggaacgggagctgaaa
cagctgcgggaggagagtgcacgcctgcgggagatgagagagaccaatgggctgctccag
gaggaggtggaagggctacagaggaagctgggacgccaggagaagatgcaggagacactg
gttggcttggagctggataacgagaagctgctggccaggctgcaaagctgggagagactg
gagcagaccatgggcttgaatgtcaggactccggaagacctttccagatttgtggtggag
ctgcagcagagggagcttgccttgaaggacaagaacagcgccatcaccagcagcgcccgg
gggctggagaaggccaggcagcagctgcaggaggagctccggcaggtcaacggtcagctg
ctggaggagaggaagaagcgtgagacacatgaggcactggcccggaggctccagaaacga
gtcctgctgctcaccaaggagcgggacggcatgcgggccatcctgggctcctacgacagc
gagctgaccccagccgagtactcgccccagctgacccggcgcatgcgggaggccgaggac
atggtgcagaaggtgcatagccacagtgccgagatggaggctcagctgtcacaggccctg
gaggagctgggaggccagaaacaaagagcagacatgctggagatggagctgaagatgcta
aagtctcagtccagctctcccgagcaaagcttcctgttctccagggaggaggtggacatg
ctcaggttgaaggttgaggagctggagggtgagcggagtcggctggaggaggaaaagagg
atgctagaggcgcagctggagcgcctcacgctgcagggtgactatgaccagagcaagacc
aaagtgctgcacatgagcctgaaccctgccagtgtggccaggcagcgcctgcgtgaagac
cacaaccagctgcaggcagagtgtgagcggctgcgagggctgctgcacaccatggagaaa
ggaggcaccgtcccagctgaccttgaggctgctgcagcaagtctgccatcgtccaaggag
gtggcagagctgaggaagcaggtggagagtgccgagctgaagaaccagcggctcaaggag
gtttttcagaccaagatccaggagtttcgcaaggcctgctacacgctcactggctaccag
atcgacatcaccacagagaaccagtatcggctgacctcgctgtatgccgagcaccagggt
gactgcctcatcttcaaggccaccggcccctcgggctccaagatgcagctgctggagacg
gagttctctcgcacggtgggcgagctcatcgaggtgcacctgcggcgccaggacagcatc
cctgccttcctcagctctctcaccctcgagctcttcagccgccagaccatgacctag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100896290Help
Entry
100896290         CDS       T03264                                 

Definition
(RefSeq) mitotic spindle assembly checkpoint protein MAD1-like
  KO
K06679  mitotic spindle assembly checkpoint protein MAD1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04110  Cell cycle
cjc04114  Oocyte meiosis
cjc04914  Progesterone-mediated oocyte maturation
cjc05166  Human T-cell leukemia virus 1 infection
cjc05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100896290
   04114 Oocyte meiosis
    100896290
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100896290
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100896290
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100896290
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cjc03036]
    100896290
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Core SAC proteins
     100896290
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAD YlqD TMPIT Laminin_II Tup_N Cauli_DNA-bind Swi5
Motif
Other DBs
NCBI-GeneID: 100896290
NCBI-ProteinID: XP_008983077
Position
2
AA seq 119 aa AA seqDB search
MTAGSPRLTWRMREAEDTVQKVHSHSAEMEAQLSQALEELGSQKQRSDTLEMELKMLKSQ
VSSSEQSFLFSREEVDMLSFRLYLNCTTGRVSSTCTSPTPFLWPPTQLEGHNIFSTLSP
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atgacagcgggctcaccccggctgacatggcgcatgcgggaggccgaggacacggtgcag
aaggtgcacagccacagcgctgagatggaggctcagctgtcgcaggccctggaggagctg
ggaagccagaaacaaagatcagacacgctcgagatggagctgaaaatgctaaagtctcag
gtcagctcttccgagcaaagcttcctgttctccagggaggaggtggacatgctcagtttc
agattgtatcttaactgtaccactggccgggtttcctccacgtgtacttcccccacaccc
tttctgtggccacccactcagttggaagggcacaatatcttctctaccctgagcccatga

DBGET integrated database retrieval system