KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100403987
Entry
100403987         CDS       T03264                                 

Gene name
MECOM
Definition
(RefSeq) MDS1 and EVI1 complex locus
  KO
K04462  ecotropic virus integration site 1 protein
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04010  MAPK signaling pathway
cjc05200  Pathways in cancer
cjc05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100403987 (MECOM)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100403987 (MECOM)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100403987 (MECOM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cjc03000]
    100403987 (MECOM)
Transcription factors [BR:cjc03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    100403987 (MECOM)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz zf-H2C2_5 zf-BED zf-C2H2_8 Zn-ribbon_8 zf-met zf-C2H2_11 PyrI_C
Other DBs
NCBI-GeneID: 100403987
NCBI-ProteinID: XP_002759448
Ensembl: ENSCJAG00000002651
UniProt: U3DP30
Position
17
AA seq 1239 aa
MRSKGRARKLATNNECVYAIYPEIPLEEMPDADGVASTPSLNIQEPCSPATSSEAFTPKE
GSPYKAPIYIPDDIPIPAEFELRESNMPGAGLGIWTKRKIEVGEKFGPYVGEQRSNLKDP
SYGWEILDEFCNVKFCIDASQPDVGSWLKYIRFAGCYDQHNLVACQINDQIFYRVVADIA
PGEELLLFMKSEDYPHETMAPDIHEERQYRCEDCDQLFESKAELADHQKFPCSTPHSAFS
MVEEDFQQKLESESDLQEIHTIQECKECDQVFPDLQSLEKHMLSHTEEREYKCDQCPKAF
NWKSNLIRHQMSHDSGKHYECENCAKVFTDPSNLQRHIRSQHVGARAHACPECGKTFATS
SGLKQHKHIHSSVKPFICEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSL
NKHRRFCEGKNHFAAGGFFGQGISLPGTPAMDKTSMVNMSHANPGLADYFGANRHPAGLT
FPTAPGFSFSFPGLFPSGLYHRPPLIPASSPVKGLSSTEQTNKSQSPLMTHPQILPATQD
ILKALSKHPPVGDNKPVELQPERSSEERPLEKISDQSESSDLDDVSTPSGSDLETTSGSD
LESDIESDKEKFKENGKMFKDKVSPLQNLASINNKKEYSNHSIFSPSLEEQTAVSGAVND
SIKAIASIAEKYFGSTGLVGLQDKKVGALPYPSMFPLPFFPAFSQSMYPFPDRDLRSLPL
KMEPQSPSEVKKLQKGSSESPFDLTTKRKEEKPLTPVPSKPPVTPATSQDQPLDLSMGSR
SRASGTKLTEPRKNHVFGEKKGSNMEPRPASDGSLQHARPTPFFMDPIYRVEKRKLTDPL
EALKEKYLRPSPGFLFHPQFQLPDQRTWMSAIENMAEKLESFSALKPEASELLQSVPSMF
NFRAPPNALPENLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSI
SSNLQRHVRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGNMSGTATSSPHSELEST
GAILDDKEDAYFTEIRNFIGNSNHGGQSPRNVEERMNGSHFKDEKALVTSHNSDLLDDEE
VEDEVLLDEEDEDNDITGKTGKEPVTSNLHEGNPEDDYEDTSTLEMSCKTSPVRYKEEEY
KSGLSALDHIRHFTDSLKMRKMEDNQYSEAELSSFSTSHVPEELKQPLHRKSKSQAYAMM
LSLSDKESLHSTSHSSSNVWHSMARAAAESSAIQSISHV
NT seq 3720 nt   +upstreamnt  +downstreamnt
atgagatccaaaggcagggcaaggaagctggccacaaataatgagtgtgtatatgccatc
taccctgaaatacctttggaagaaatgccagatgcagacggagtagccagcactccctcc
ctcaatattcaagagccatgctcacctgccacatccagtgaagccttcactccaaaggag
ggctctccttacaaagcccccatctacatccctgatgatatcccaattcctgctgagttt
gaacttcgagagtcaaatatgcctggagcaggactaggaatatggaccaaaaggaagatc
gaagtaggtgaaaagtttgggccttatgtgggagagcagagatcaaacctgaaagatcct
agttatggatgggagatcttagatgagttttgcaatgtgaagttctgcatagatgccagt
caaccagatgtaggaagctggctcaagtacattagattcgctggctgttatgatcagcac
aacctcgttgcatgccagataaatgatcagatattctacagagtagttgcagacattgcg
ccgggagaggagcttctgctgttcatgaagagcgaagactatccccatgaaacgatggcg
ccggacatccacgaagaacggcaatatcgctgtgaagactgtgatcagctctttgaatct
aaggctgaactagcagatcaccaaaagtttccttgcagtactcctcactcagcattttca
atggttgaagaggacttccagcaaaaacttgaaagcgagagtgatctccaagagatacac
acgatccaggagtgtaaggaatgtgaccaggtttttcctgatttgcaaagcctggagaaa
cacatgctgtcacatactgaagagagggaatacaagtgtgatcagtgtcccaaggcattt
aactggaagtccaatttaattcgccaccagatgtcacatgacagtggaaagcactatgaa
tgtgaaaactgtgccaaggttttcacggaccctagcaaccttcagcggcacattcgctct
cagcatgtcggtgcccgggcccatgcttgcccggagtgtggcaaaacgtttgccacttcg
tcgggcctcaaacaacacaagcacatccacagcagtgtgaagccctttatctgtgaggtc
tgccataaatcctatactcagttttcaaacctttgtcgtcataagcgcatgcatgctgat
tgcagaacccaaatcaagtgcaaagactgtggacaaatgttcagcactacgtcttcctta
aataaacacaggaggttttgtgagggcaagaaccattttgcggcaggtggattttttggc
caaggcatttcacttcctggaaccccagctatggataaaacgtccatggttaatatgagt
catgccaacccgggcctagctgactattttggcgccaataggcatcctgctggtcttacc
tttccaacagctcctggattttcttttagcttccctggtctgtttccttccggcttgtac
cacaggcctcctttgatacctgctagttctcctgttaaaggactatcaagtactgaacag
acaaacaaaagtcaaagtcccctcatgacacatcctcagatactgccagctacacaggat
attttgaaggcactatctaaacacccacctgtaggggacaataagccagtggagctccag
cccgagaggtcctctgaagagaggccccttgagaaaatcagtgaccagtcagagagtagt
gaccttgatgatgtcagtacgccaagtggcagtgacctggaaacaacctcgggctctgat
ctggaaagtgacattgaaagtgataaagagaaatttaaagaaaatggtaaaatgttcaaa
gacaaagtaagccctcttcagaatctggcttcaataaataataagaaagaatacagcaat
cattccattttctcaccatctttagaggagcagactgcggtgtcaggagctgtgaatgat
tctataaaggctattgcttctattgctgaaaaatactttggttcaacaggactggtgggg
ctgcaagacaaaaaagttggagctttaccttacccttccatgtttcccctcccatttttt
ccagcattctcccaatcaatgtacccatttcctgatagagacttgagatcgttacctttg
aaaatggaaccccaatcaccaagtgaagttaagaaactgcagaagggcagctctgagtcc
ccctttgatctcactactaagcgaaaagaggagaagcccttgactccagtaccctccaag
cctccagtgacgcctgccacaagccaagaccagcccctcgatctaagtatgggcagtagg
agtagagccagtgggacaaagctgactgagcctcgaaaaaaccacgtgtttggggaaaaa
aaaggaagcaacatggaaccaagaccagcttcagacggttccttgcagcatgcaagaccc
actcctttctttatggaccctatttacagagtagagaaaagaaaactaactgacccactt
gaagctttgaaagagaaatacttgaggccttctccaggattcttgtttcacccacaattc
caactgcctgatcagagaacttggatgtcagctattgaaaacatggctgaaaagctagag
agcttcagtgccctaaaacctgaggccagtgagctcctacagtcagtgccctctatgttc
aacttcagagcacctcccaatgcccttccagagaaccttctgcggaagggaaaggagcgc
tatacctgcagatactgtggcaagattttcccaaggtctgcaaacctaacacggcacttg
agaacccacacaggagagcaaccttacagatgcaaatactgtgacagatcatttagtata
tcttctaacttgcagaggcatgttcgaaacattcacaataaagagaagccatttaagtgt
cacttatgtgataggtgttttggtcaacaaaccaatttagacagacacctaaagaaacat
gagaatgggaacatgtctggtacagcaacatcgtcgcctcattctgaactggaaagtaca
ggtgcgattctggatgacaaagaagatgcttacttcacagaaattcgaaatttcattggg
aatagcaaccatggtggccagtctcccaggaatgtggaagagagaatgaatggcagtcac
tttaaggatgaaaaggctttggtgactagtcacaattcagacttactggatgatgaagaa
gttgaagatgaggtgttgttagatgaggaggacgaggataatgatattactggaaaaaca
ggaaaggaaccagtgacaagtaatttacatgaaggaaaccctgaggatgactatgaagac
accagtaccctggagatgagttgcaagacatccccagtgaggtataaagaggaagaatat
aaaagtggactttctgctctagatcatataaggcacttcacagatagcctcaaaatgagg
aaaatggaagataatcaatattctgaagctgagctgtcttcttttagtacttcccatgtg
ccagaggaacttaagcaaccattacacagaaagtccaaatcacaggcatatgctatgatg
ctgtcattgtctgacaaggagtccctccattctacatcccacagttcttccaacgtgtgg
cacagtatggccagagctgcggcggaatccagtgctatccagtccataagccacgtatga

DBGET integrated database retrieval system