KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100404177Help
Entry
100404177         CDS       T03264                                 

Gene name
BLVRA
Definition
(RefSeq) biliverdin reductase A
  KO
K00214  biliverdin reductase [EC:1.3.1.24]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00860  Porphyrin and chlorophyll metabolism
cjc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    100404177 (BLVRA)
Enzymes [BR:cjc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.24  biliverdin reductase
     100404177 (BLVRA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Biliv-reduc_cat GFO_IDH_MocA
Motif
Other DBs
NCBI-GeneID: 100404177
NCBI-ProteinID: XP_002751408
Ensembl: ENSCJAG00000007829
UniProt: U3ER63
Position
8
AA seq 296 aa AA seqDB search
MNTEPERKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLE
DALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVLVEYPMTLSLVAAQALWELAAQKGKV
LHEEHVELLMEEFAFLKKEVVGKDLLKGSLLFTAGPLEEERFGFPAFSGISRLTWLVSLF
GELSLVSATLEERKEDQYMKMTVCLETEKKSPLTWIEEKGPGLKRNRYLSFHFKSGSLEN
VPNVGINKNIFLKDQNIFVQKLLGQFSEKELAAEKKRILHCLGLAEEIQKYCCSGK
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaatacagagcccgagaggaagtttggagtggtggtggtgggtgttggcagagccggc
tccgtgcggatgagggacttgcggaatccacacccttcctcggcgttcctgaacctgatt
ggctttgtgtccagacgggagcttgggagcattgacggagtccagcagatttccttggag
gatgctctttccagccaagaggtggaagtcgcctatatctgcagtgagagctccagccat
gaggactacatcaggcagttccttaacgctggcaagcatgtccttgtggaataccccatg
acgctgtcgttggtggctgctcaggcactgtgggagctggctgcgcagaaaggcaaagtc
ttgcacgaggagcatgttgaactcttgatggaggaatttgcatttctaaaaaaagaagtg
gtggggaaagacctgctgaaagggtcgcttctcttcacagctggcccgttggaagaagag
cggtttggcttccccgcattcagtggcatctctcgcctgacctggctggtctccctcttt
ggggagctttctcttgtgtctgccactttggaagagcgaaaggaagatcagtatatgaaa
atgacagtgtgcctggagacagagaagaaaagtccactgacatggattgaagaaaaaggg
cctggtctaaaacgaaacagatatttaagcttccatttcaagtctgggtccctggagaat
gtgccaaatgtaggaataaataagaatatatttctgaaagatcaaaatatatttgtccag
aaactcttgggccagttctctgagaaggaactggctgctgaaaagaaacggatcctacac
tgcctggggctcgcagaagaaatccagaaatactgctgttcagggaagtaa

DBGET integrated database retrieval system