KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100404181Help
Entry
100404181         CDS       T03264                                 

Gene name
ORC5, ORC5L
Definition
(RefSeq) origin recognition complex subunit 5
  KO
K02607  origin recognition complex subunit 5
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100404181 (ORC5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cjc01009]
    100404181 (ORC5)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cjc03032]
    100404181 (ORC5)
Protein phosphatases and associated proteins [BR:cjc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100404181 (ORC5)
DNA replication proteins [BR:cjc03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    100404181 (ORC5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ORC5_C AAA_16 AAA_22 Kinesin ATPase_2 AAA_24
Motif
Other DBs
NCBI-GeneID: 100404181
NCBI-ProteinID: XP_002751732
Ensembl: ENSCJAG00000012572
UniProt: F7I1U2
Position
8
AA seq 435 aa AA seqDB search
MTHLENVVLCRESQVSTLQSLFGERHHFSFPSIFIYGHTASGKTYVTQTLLKTLELPHVF
VNCVECFTLRLLLEQILNKLNNLSSSEDGCSSEITCETFNDFVRLFKQVTKAENLKDQTV
YIVLDKAEYLRDMEANLLPGFLRLQELADRNVTVIFLSEIVWEKFRPNTGCFEPFVLYFP
DYSIGNLQKILSHDHPPEYSADFYAAYINILLGVFYTVCRDLKELRHLAVLNFPKYCEPV
VRGEASERDTRKLWRNIEPHLKKAMQTVYLREISSSQWEKLQKDDTDLGQLKGLSAHTHV
ELPYYSKFILIAAYLASYNPARTDRRFFLKHHGKIKKTNFLKKHEKTSNHLLGPKPFPLD
RLLAILYSIVDSRVAPTANIFSQITSLVTLQLLTLVGHDDQLDGPKYKCTVSLDFIRAIS
RTVNFDIIKYLYDFL
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgacccacttggaaaacgtggtgctttgtcgcgagtctcaagtgtccaccttgcagtcc
ttgtttggagagagacatcatttcagctttccatccatttttatttatggacatactgcc
agtggaaagacctatgtaacacaaactttgttgaaaactttagagctcccacatgtcttt
gtgaattgtgttgaatgctttaccttaaggctgcttttggaacaaattttaaacaaattg
aataatcttagttcttcagaggatggatgttcttccgaaataacctgtgaaacatttaat
gactttgttcgcttgtttaaacaagtaaccaaagctgaaaatctcaaggatcagaccgta
tatattgttctagataaagcagagtatctaagagatatggaagcaaatcttttgcctgga
tttcttagattacaggaattggctgacagaaatgtgactgttatctttctcagtgaaatt
gtttgggaaaagtttcgtccaaatactggatgctttgagccatttgtcttgtattttcct
gattacagcatagggaaccttcaaaagatcctttcccatgatcatcctccagagtattca
gctgatttctatgctgcctacattaacattcttcttggagttttctacactgtttgtcga
gatttgaaagagctcagacatctggcagtacttaattttcctaaatattgtgaacctgtg
gttagaggagaagcaagtgaacgtgatactcgcaaactgtggagaaatattgaacctcat
ttgaagaaagccatgcagactgtttatctcagggaaatatcaagttcccagtgggaaaag
ctacagaaagatgacacagatctggggcaactgaaaggtctctcagcgcatactcatgtg
gaacttccatattactctaagtttattctaattgctgcataccttgcttcatacaatcca
gcgagaactgacaggaggttctttcttaagcatcatggaaaaatcaagaaaaccaacttt
ctaaaaaaacacgaaaagacgagcaatcatctccttgggccaaaaccatttccactagac
agattattagcaatattatatagtattgtggacagcagagttgctccaacagcaaatatt
ttttcccagattacttctctagtgacccttcagctgttaactctggttggccatgacgat
cagcttgatggaccaaaatacaaatgcacagtgtctctggatttcatcagagctatttca
aggacggtgaactttgacataataaaatacttgtacgatttcttgtga

DBGET integrated database retrieval system