KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100404226Help
Entry
100404226         CDS       T03264                                 

Gene name
TRAF2
Definition
(RefSeq) TNF receptor associated factor 2
  KO
K03173  TNF receptor-associated factor 2 [EC:2.3.2.27]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04010  MAPK signaling pathway
cjc04064  NF-kappa B signaling pathway
cjc04071  Sphingolipid signaling pathway
cjc04141  Protein processing in endoplasmic reticulum
cjc04210  Apoptosis
cjc04217  Necroptosis
cjc04380  Osteoclast differentiation
cjc04621  NOD-like receptor signaling pathway
cjc04622  RIG-I-like receptor signaling pathway
cjc04657  IL-17 signaling pathway
cjc04668  TNF signaling pathway
cjc04920  Adipocytokine signaling pathway
cjc04932  Non-alcoholic fatty liver disease (NAFLD)
cjc05160  Hepatitis C
cjc05163  Human cytomegalovirus infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05200  Pathways in cancer
cjc05203  Viral carcinogenesis
cjc05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100404226 (TRAF2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100404226 (TRAF2)
   04064 NF-kappa B signaling pathway
    100404226 (TRAF2)
   04668 TNF signaling pathway
    100404226 (TRAF2)
   04071 Sphingolipid signaling pathway
    100404226 (TRAF2)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100404226 (TRAF2)
   04217 Necroptosis
    100404226 (TRAF2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100404226 (TRAF2)
   04622 RIG-I-like receptor signaling pathway
    100404226 (TRAF2)
   04657 IL-17 signaling pathway
    100404226 (TRAF2)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100404226 (TRAF2)
  09158 Development
   04380 Osteoclast differentiation
    100404226 (TRAF2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100404226 (TRAF2)
   05203 Viral carcinogenesis
    100404226 (TRAF2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100404226 (TRAF2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100404226 (TRAF2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100404226 (TRAF2)
   05160 Hepatitis C
    100404226 (TRAF2)
   05168 Herpes simplex virus 1 infection
    100404226 (TRAF2)
   05163 Human cytomegalovirus infection
    100404226 (TRAF2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100404226 (TRAF2)
   05169 Epstein-Barr virus infection
    100404226 (TRAF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cjc03019]
    100404226 (TRAF2)
   04121 Ubiquitin system [BR:cjc04121]
    100404226 (TRAF2)
Enzymes [BR:cjc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100404226 (TRAF2)
Messenger RNA biogenesis [BR:cjc03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     100404226 (TRAF2)
Ubiquitin system [BR:cjc04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    100404226 (TRAF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRAF_BIRC3_bd zf-TRAF zf-C3HC4 zf-C3HC4_2 zf-RING_6 zf-C3HC4_4 MATH DUF848 SlyX Dynamitin
Motif
Other DBs
NCBI-GeneID: 100404226
NCBI-ProteinID: XP_003732128
Ensembl: ENSCJAG00000011179
UniProt: U3B0E4
Position
1
AA seq 501 aa AA seqDB search
MAAASVTPPGSLELLQPGFSKTLLGTKLEAKYLCSACRNVLRRPFQAQCGHRYCSFCLAS
ILSSGPQNCAACVHEGIYEEGISILESSSAFPDNAARREVESLPAVCPSDGCTWKGTLKE
YESCHEGRCPLMLTECPACKGLVRLGDKERHLEHECPERSLSCRHCRAPCCGADVKAHHE
VCPKFPLTCDGCGKKKIPREKFQDHIKTCGKCRVPCRFHALGCLETVEGEKQQEHEAQWL
REHLAMLLSSVLETKPLSGDQSQVGSELLQRCETLEKKTATFENIVCVLNREVERVALTV
EACSRQHRLDLDRIEALSNKVQQLERSIGLKDLAMADLEQKVLEMEASTYDGVFIWKISD
FARKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDA
LLRWPFNQKVTLMLLDQNNREHVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEA
KNSYVRDDAIFIKAIVDLTGL
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggctgccgctagcgtgaccccccctggctccctggagttgctacagcctggcttctcc
aagaccctcctggggaccaaactggaagctaagtacctgtgctctgcctgcagaaacgtc
ctgcgaaggcccttccaggcgcagtgtggccaccgctactgctccttctgcctggccagc
atcctcagctctgggcctcagaactgtgctgcgtgtgttcacgagggcatatatgaagaa
ggcatttctattttagaaagcagttcggccttcccagacaatgctgcccgcagggaggtg
gagagcctgccggccgtctgtcccagtgatgggtgtacctggaaggggaccctgaaggaa
tacgagagctgccacgaaggccgctgcccgctcatgctgaccgaatgccccgcgtgcaaa
ggcctggtccgcctcggtgacaaggagcgccacctggagcatgagtgtccggagagaagc
ctgagctgccggcactgccgggcaccctgctgcggggcagacgtgaaggcgcaccatgaa
gtttgccccaagttccccttgacctgtgatggctgcggcaagaagaagatcccccgggag
aagtttcaggaccatatcaagacgtgtggcaagtgtcgagtcccttgcagattccatgcc
ctcggctgcctcgagacggtggagggcgagaagcagcaggagcacgaggcgcagtggctg
cgggagcacctggccatgctactgagctcggtcctggagacaaagcccctctcaggagac
cagagccaggtggggtcagagctcctgcagaggtgcgagacactggagaagaagacagcc
acctttgagaacatcgtctgtgtcctgaaccgggaggtggagagggtggccctgaccgtc
gaggcctgtagccggcagcaccggctggacctagacaggattgaagccctgagtaacaag
gtgcagcagctggagaggagcatcggcctgaaggacctggcaatggccgacctggagcag
aaggtcttggagatggaggcgtccacctacgatggggtcttcatctggaagatctcagac
ttcgccaggaagcgccaggaagctgtggccggccgcacacctgccatcttctccccagcc
ttctacaccagcaggtacggctacaagatgtgtctgcgcatctacctgaatggcgacggc
actgggcgcgggacccacctgtccctcttcttcgtggtgatgaaaggcccgaacgacgcc
ctgcttcggtggcccttcaaccagaaggtgaccctgatgctgctggaccagaacaaccgg
gagcacgtgattgacgccttcagacccgatgtgacctcatcctctttccagaggccagtc
aatgacatgaacatcgcaagtggctgccccctcttctgccccgtctccaagatggaggcc
aagaattcctatgtgcgggacgatgccatcttcatcaaggccattgtggacctgacaggg
ctctaa

DBGET integrated database retrieval system