KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100404291Help
Entry
100404291         CDS       T03264                                 

Gene name
CDC42
Definition
(RefSeq) cell division cycle 42
  KO
K04393  cell division control protein 42
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04010  MAPK signaling pathway
cjc04014  Ras signaling pathway
cjc04015  Rap1 signaling pathway
cjc04062  Chemokine signaling pathway
cjc04144  Endocytosis
cjc04360  Axon guidance
cjc04370  VEGF signaling pathway
cjc04510  Focal adhesion
cjc04520  Adherens junction
cjc04530  Tight junction
cjc04660  T cell receptor signaling pathway
cjc04666  Fc gamma R-mediated phagocytosis
cjc04670  Leukocyte transendothelial migration
cjc04722  Neurotrophin signaling pathway
cjc04810  Regulation of actin cytoskeleton
cjc04912  GnRH signaling pathway
cjc04932  Non-alcoholic fatty liver disease (NAFLD)
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc05100  Bacterial invasion of epithelial cells
cjc05132  Salmonella infection
cjc05135  Yersinia infection
cjc05165  Human papillomavirus infection
cjc05200  Pathways in cancer
cjc05203  Viral carcinogenesis
cjc05205  Proteoglycans in cancer
cjc05211  Renal cell carcinoma
cjc05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100404291 (CDC42)
   04015 Rap1 signaling pathway
    100404291 (CDC42)
   04010 MAPK signaling pathway
    100404291 (CDC42)
   04370 VEGF signaling pathway
    100404291 (CDC42)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100404291 (CDC42)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100404291 (CDC42)
   04520 Adherens junction
    100404291 (CDC42)
   04530 Tight junction
    100404291 (CDC42)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100404291 (CDC42)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100404291 (CDC42)
   04666 Fc gamma R-mediated phagocytosis
    100404291 (CDC42)
   04670 Leukocyte transendothelial migration
    100404291 (CDC42)
   04062 Chemokine signaling pathway
    100404291 (CDC42)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100404291 (CDC42)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100404291 (CDC42)
  09158 Development and regeneration
   04360 Axon guidance
    100404291 (CDC42)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100404291 (CDC42)
   05205 Proteoglycans in cancer
    100404291 (CDC42)
   05203 Viral carcinogenesis
    100404291 (CDC42)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100404291 (CDC42)
   05211 Renal cell carcinoma
    100404291 (CDC42)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100404291 (CDC42)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100404291 (CDC42)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100404291 (CDC42)
   05135 Yersinia infection
    100404291 (CDC42)
   05100 Bacterial invasion of epithelial cells
    100404291 (CDC42)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100404291 (CDC42)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100404291 (CDC42)
   03036 Chromosome and associated proteins [BR:cjc03036]
    100404291 (CDC42)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100404291 (CDC42)
   04031 GTP-binding proteins [BR:cjc04031]
    100404291 (CDC42)
Membrane trafficking [BR:cjc04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    100404291 (CDC42)
 Endocytosis
  Lipid raft mediated endocytosis
   GRAF1-dependent endocytosis
    100404291 (CDC42)
  Macropinocytosis
   Ras GTPases
    100404291 (CDC42)
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100404291 (CDC42)
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   100404291 (CDC42)
  Exosomal proteins of breast milk
   100404291 (CDC42)
GTP-binding proteins [BR:cjc04031]
 Small (Monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    100404291 (CDC42)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf PET117 GTP_EFTU
Motif
Other DBs
NCBI-GeneID: 100404291
NCBI-ProteinID: XP_002750448
Ensembl: ENSCJAG00000005912
UniProt: U3DLZ3
Position
7
AA seq 191 aa AA seqDB search
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG
QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR
DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPP
EPKKSRRCVLL
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgcagacaattaagtgtgttgttgtgggtgatggtgctgttggtaaaacatgtctcctg
atatcctacacaacaaacaaatttccatcagaatatgtaccgactgtttttgacaactat
gcagtcacagttatgattggtggagagccatatactcttggactttttgatactgcaggg
caagaggattatgacagattacgaccgctgagttatccacaaacagatgtatttctagtc
tgtttttcagtggtttctccatcttcatttgaaaatgtgaaagaaaagtgggtgcctgag
ataactcaccactgtccaaagactcctttcttgcttgttgggacccaaattgatctcaga
gatgacccctctactattgagaaacttgccaagaacaaacagaaacctatcactccagag
actgctgaaaagctggcccgtgacctgaaggctgtcaagtatgtggagtgttctgcactc
acacagaaaggcctaaagaatgtatttgacgaagcaatattggctgccctggagcctcca
gaaccgaagaagagccgcaggtgtgtgctgctatga

DBGET integrated database retrieval system