KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100404307Help
Entry
100404307         CDS       T03264                                 

Gene name
B2M
Definition
(RefSeq) beta-2-microglobulin
  KO
K08055  beta-2-microglobulin
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04612  Antigen processing and presentation
cjc05163  Human cytomegalovirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    100404307 (B2M)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100404307 (B2M)
   05170 Human immunodeficiency virus 1 infection
    100404307 (B2M)
   05168 Herpes simplex virus 1 infection
    100404307 (B2M)
   05163 Human cytomegalovirus infection
    100404307 (B2M)
   05169 Epstein-Barr virus infection
    100404307 (B2M)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100404307 (B2M)
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   100404307 (B2M)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: C1-set Ig_3 Ig_2 I-set
Motif
Other DBs
NCBI-GeneID: 100404307
NCBI-ProteinID: XP_002753457
Ensembl: ENSCJAG00000002377
UniProt: P63061 U3FI69
Position
10
AA seq 119 aa AA seqDB search
MASSVVVALLVLLSLSGLEAIQHAPKIQVYSRHPAENGKPNFLNCYVSGFHPSDIEVDLL
KNGKKIEKVEHSDLSFSKDWSFYLLYYTEFTPSEKDEYACRVSHVTFSTPKTVKWDRNI
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atggctagctccgtggtggtagccctgctcgtgctactctctctgtctggcctggaggct
attcagcatgctccaaagattcaggtttactcacgtcatccggcagagaatggaaagcca
aatttcctcaattgctatgtgtctgggtttcatccatctgacattgaagttgacttactg
aagaatggaaagaaaattgaaaaagtggagcattcagacttgtctttcagcaaggactgg
tctttctatctcttgtactacaccgagtttacccccagtgaaaaagatgagtatgcctgc
cgtgtgagccatgtgactttctcaacacccaagacagtaaagtgggatcgaaacatttaa

DBGET integrated database retrieval system