KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100404359Help
Entry
100404359         CDS       T03264                                 

Gene name
TGFBR2
Definition
(RefSeq) transforming growth factor beta receptor 2
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04010  MAPK signaling pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04068  FoxO signaling pathway
cjc04144  Endocytosis
cjc04218  Cellular senescence
cjc04350  TGF-beta signaling pathway
cjc04380  Osteoclast differentiation
cjc04390  Hippo signaling pathway
cjc04520  Adherens junction
cjc04659  Th17 cell differentiation
cjc04926  Relaxin signaling pathway
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc05142  Chagas disease (American trypanosomiasis)
cjc05161  Hepatitis B
cjc05166  Human T-cell leukemia virus 1 infection
cjc05200  Pathways in cancer
cjc05202  Transcriptional misregulation in cancer
cjc05210  Colorectal cancer
cjc05212  Pancreatic cancer
cjc05220  Chronic myeloid leukemia
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
Module
cjc_M00680  TGF-beta signaling
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100404359 (TGFBR2)
   04350 TGF-beta signaling pathway
    100404359 (TGFBR2)
   04390 Hippo signaling pathway
    100404359 (TGFBR2)
   04068 FoxO signaling pathway
    100404359 (TGFBR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100404359 (TGFBR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100404359 (TGFBR2)
  09143 Cell growth and death
   04218 Cellular senescence
    100404359 (TGFBR2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100404359 (TGFBR2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100404359 (TGFBR2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100404359 (TGFBR2)
  09158 Development
   04380 Osteoclast differentiation
    100404359 (TGFBR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100404359 (TGFBR2)
   05202 Transcriptional misregulation in cancer
    100404359 (TGFBR2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100404359 (TGFBR2)
   05212 Pancreatic cancer
    100404359 (TGFBR2)
   05225 Hepatocellular carcinoma
    100404359 (TGFBR2)
   05226 Gastric cancer
    100404359 (TGFBR2)
   05220 Chronic myeloid leukemia
    100404359 (TGFBR2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100404359 (TGFBR2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100404359 (TGFBR2)
   05161 Hepatitis B
    100404359 (TGFBR2)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    100404359 (TGFBR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100404359 (TGFBR2)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     100404359 (TGFBR2)
Protein kinases [BR:cjc01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   100404359 (TGFBR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ecTbetaR2 Pkinase_Tyr Pkinase Haspin_kinase Pkinase_fungal APH
Motif
Other DBs
NCBI-GeneID: 100404359
NCBI-ProteinID: XP_002759726
Ensembl: ENSCJAG00000004363
UniProt: F6Z930
Position
17
AA seq 593 aa AA seqDB search
MGRGLLRGLWPLHIVLWTRIASTIPPQVPKSDVKMEHQKDEIIRPGCNRTAHPLTHINND
IMVTDNNGAVKLPQLCKFCDVRFSTCDNQKSCMSNCSITAICEKPQEVCVAVWRKNDENI
TLETVCHDPRLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSEECNDNIIFSEDYNT
SNPDLLLVIFQVTGVSLLPPLAIAISVIIIFYCYRVNRQQKLSSSWETAKPRKLMEFSSE
HCAIILEDDRSDISSTCANNINHNTELLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETV
AVKIFPYEEYASWKTEKDIFSDVNLKHENILQFLTAEERKTELGKQYWLITAFHAKGNLQ
EYLTRHIISWEDLSKLGSSLARGIAHLHSDHTPCGRPKVPIVHRDLKSSNILVKNDLTCC
LCDFGLSLRLDPALSVDDLANSGQVGTARYMAPEVLESRMNLENVESFKQTDVYSMALVL
WEMTSRCNAVGEVKDYEPPFGSKVREHPCVESMKDNVLRDRGRPEIPSFWLNHQGIQMVC
ETLTECWDHDPEARLTAQCVAERFSELEHLDRLSGRSCSEEKIPEDGSLNTTK
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgggggctgctcaggggcctgtggccgctgcacatcgtcctgtggacgcgcatc
gccagcacgatcccaccgcaagttccgaagtcggatgtgaaaatggagcaccagaaagat
gaaatcatccgtccaggctgtaataggactgcccatccactgacacatattaataacgac
atcatggtcaccgacaacaatggtgcagtcaagcttccacaactgtgtaaattttgtgat
gtgagattttccacctgtgacaaccagaagtcctgcatgagcaactgtagtatcaccgcc
atctgtgagaagccacaggaagtctgtgtggctgtatggagaaagaatgacgagaacata
acactagagactgtttgccatgaccccaggctcccctaccatgactttattctggaagat
gctgcttctccaaagtgcattatgaaggaaaaaaaaaagcctggcgagactttcttcatg
tgttcctgtagctctgaagagtgcaatgacaacatcatcttctcagaagactataacacc
agcaatcctgacttgctgctagtcatatttcaagtgacaggcgtcagcctcctgccacca
ctagcaatcgccatatctgtcatcatcatcttctactgctatcgcgtgaaccggcagcag
aagctgagttcatcctgggaaaccgccaagccacggaagctcatggagttcagcagcgag
cactgtgccatcatcctggaagatgaccgctccgacatcagctccacgtgcgccaacaac
atcaaccacaacacggagctgctgcccattgagctggacacgctggtggggaaaggtcgc
tttgctgaggtctataaggccaagctgaagcagaacacttcagagcagtttgagacagtg
gcagtcaagatctttccctatgaggagtatgcctcttggaagacggagaaggacatcttc
tcagatgtcaacctgaagcatgagaacatactccagttcctgacggccgaggagcggaag
acggagttggggaaacagtactggctgatcaccgccttccacgccaagggcaacctacag
gagtacctgacacggcatatcatcagctgggaggacctgagcaagctgggcagctccctc
gcccggggcattgctcacctccacagtgatcacaccccttgcgggaggcccaaggtgccc
atcgtgcacagggacctcaagagctccaatatccttgtgaagaacgacctgacttgctgc
ctgtgtgactttgggctttccctgcgactggaccctgctctgtctgtggatgacctggct
aacagcgggcaggtgggaactgcaagatacatggctccagaagtcctagaatccaggatg
aatttggagaacgttgagtccttcaagcagaccgatgtctactccatggctctggtgctc
tgggaaatgacatctcgctgcaatgcagtgggagaagtaaaagattatgagcctccattt
ggttccaaagtgcgggagcacccctgtgtcgagagcatgaaggacaacgtgttgagagat
cgaggacgaccagaaattcccagcttctggctcaaccaccagggcatccagatggtgtgt
gagacgttgactgagtgctgggaccacgacccggaggcccgtctcacagcccagtgtgtg
gcggaacgcttcagtgagctggagcacctggacaggctctcggggaggagctgctctgag
gagaagattcctgaagacggctccctaaacactaccaaatag

DBGET integrated database retrieval system