KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100404544Help
Entry
100404544         CDS       T03264                                 

Gene name
SLC2A1
Definition
(RefSeq) solute carrier family 2 member 1
  KO
K07299  MFS transporter, SP family, solute carrier family 2 (facilitated glucose transporter), member 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04066  HIF-1 signaling pathway
cjc04911  Insulin secretion
cjc04919  Thyroid hormone signaling pathway
cjc04920  Adipocytokine signaling pathway
cjc04922  Glucagon signaling pathway
cjc04931  Insulin resistance
cjc04976  Bile secretion
cjc05166  Human T-cell leukemia virus 1 infection
cjc05200  Pathways in cancer
cjc05211  Renal cell carcinoma
cjc05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100404544 (SLC2A1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100404544 (SLC2A1)
   04922 Glucagon signaling pathway
    100404544 (SLC2A1)
   04920 Adipocytokine signaling pathway
    100404544 (SLC2A1)
   04919 Thyroid hormone signaling pathway
    100404544 (SLC2A1)
  09154 Digestive system
   04976 Bile secretion
    100404544 (SLC2A1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100404544 (SLC2A1)
   05230 Central carbon metabolism in cancer
    100404544 (SLC2A1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100404544 (SLC2A1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100404544 (SLC2A1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100404544 (SLC2A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cjc02000]
    100404544 (SLC2A1)
Transporters [BR:cjc02000]
 Solute Carrier Family (SLC)
  SLC2: Facilitative GLUT transporter
   100404544 (SLC2A1)
 Major Facilitator Superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    100404544 (SLC2A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sugar_tr MFS_1 DUF2127 DUF523 Pox_EPC_I2-L1
Motif
Other DBs
NCBI-GeneID: 100404544
NCBI-ProteinID: XP_002750748
Ensembl: ENSCJAG00000003279
UniProt: F6PYB0
Position
7
AA seq 492 aa AA seqDB search
MEPSSKKLTGRLMLAVGGAVLGSLQFGYNTGVINAPQKVIEEFYNQTWIHRYGESILPTT
LTTLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLMMNLLAFVSAVLMGFSKLGKSFE
MLILGRFIIGVYCGLTTGFVPMYVGEVSPTALRGALGTLHQLGIVVGILIAQVFGLDSIM
GNEDLWPLLLSIIFVPALLQCTVLPFCPESPRFLLINRNEENRAKSVLKKLRGTADVTHD
LQEMKEESRQMMREKKVTILELFRSAAYRQPILIAVVLQLSQQLSGINAVFYYSTSIFEK
AGVQQPVYATIGSGIVNTAFTVVSLFVVERAGRRTLHLIGLAGMAGCAILMTIALALLEQ
LPWMSYLSIVAIFGFVAFFEVGPGPIPWFIVAELFSQGPRPAAIAVAGFSNWTSNFIVGM
CFQYVEQLCGPYVFIIFTVLLVLFFIFTYFKVPETKGRTFDEIASGFRQGGNSQSDKTPE
ELFHPLGADSQV
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggagcccagcagcaagaagctgacgggtcgcctcatgctggccgtgggaggggcagtg
ctcggctccctgcagtttggctacaacactggagtcatcaatgccccccagaaggtgatc
gaggagttctacaaccagacatggatccaccgctatggggagagcatcctgcccaccacg
ctcaccacgctctggtccctctcagtggccatcttctccgttgggggcatgattggctcc
ttctctgtgggccttttcgttaaccgctttggccggcggaattcaatgctgatgatgaac
ctgctggccttcgtgtctgccgtgctcatgggcttctcgaaactgggcaagtcctttgag
atgctgatcctgggccgcttcatcatcggcgtgtactgcggactgaccacaggcttcgtg
cccatgtatgtgggtgaagtgtcacccacagcccttcgtggggccctgggcaccctgcac
cagctgggcatcgttgttggcatcctcatcgcccaggtgtttggcctggactccatcatg
ggcaatgaggacctgtggcccctgctgctgagcatcatcttcgtcccggccctgctgcag
tgcactgtgctgcccttctgccccgagagcccccgcttcctgctcatcaaccgcaacgag
gagaaccgggccaagagtgtgctgaagaagctgcgcgggacggctgacgtgacccatgac
ctgcaggagatgaaggaggagagtcgacagatgatgcgggagaagaaggtcaccatcctg
gagctgttccgctcggccgcctaccgtcagcccatcctcatcgccgtggtgctgcagctg
tcccagcagctgtcaggcatcaacgctgtcttctattactccacaagcatctttgagaag
gcaggagtgcagcagcctgtgtacgccaccatcggctccggcatcgtcaacacggccttc
accgtcgtgtcgctatttgtggtggagcgagcaggccggcggaccctgcacctcataggc
ctggctggcatggcgggttgtgccatactcatgaccatcgcgctggcactgctggagcag
ctgccctggatgtcctatctgagcattgtggccatttttggcttcgtggccttctttgaa
gtgggtcccggccccatcccatggttcatcgtggctgaactcttcagccagggtcctcgt
ccagctgccattgctgttgcaggcttctccaactggacctcaaatttcattgtgggcatg
tgcttccagtatgtggagcaactgtgtggtccctacgtcttcatcatcttcactgtgctc
ctggttctgttcttcatcttcacctacttcaaagttcctgagactaaaggccggaccttc
gatgagattgcttccggcttccggcaggggggaaacagccaaagtgacaagacacccgaa
gagctgttccatcctctgggggctgattcccaagtgtga

DBGET integrated database retrieval system