KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100404815
Entry
100404815         CDS       T03264                                 
Symbol
MAPK3
Name
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01521  EGFR tyrosine kinase inhibitor resistance
cjc01522  Endocrine resistance
cjc01524  Platinum drug resistance
cjc04010  MAPK signaling pathway
cjc04012  ErbB signaling pathway
cjc04014  Ras signaling pathway
cjc04015  Rap1 signaling pathway
cjc04022  cGMP-PKG signaling pathway
cjc04024  cAMP signaling pathway
cjc04062  Chemokine signaling pathway
cjc04066  HIF-1 signaling pathway
cjc04068  FoxO signaling pathway
cjc04071  Sphingolipid signaling pathway
cjc04072  Phospholipase D signaling pathway
cjc04114  Oocyte meiosis
cjc04140  Autophagy - animal
cjc04148  Efferocytosis
cjc04150  mTOR signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc04210  Apoptosis
cjc04218  Cellular senescence
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04270  Vascular smooth muscle contraction
cjc04350  TGF-beta signaling pathway
cjc04360  Axon guidance
cjc04370  VEGF signaling pathway
cjc04371  Apelin signaling pathway
cjc04380  Osteoclast differentiation
cjc04510  Focal adhesion
cjc04520  Adherens junction
cjc04540  Gap junction
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc04611  Platelet activation
cjc04613  Neutrophil extracellular trap formation
cjc04620  Toll-like receptor signaling pathway
cjc04621  NOD-like receptor signaling pathway
cjc04625  C-type lectin receptor signaling pathway
cjc04650  Natural killer cell mediated cytotoxicity
cjc04657  IL-17 signaling pathway
cjc04658  Th1 and Th2 cell differentiation
cjc04659  Th17 cell differentiation
cjc04660  T cell receptor signaling pathway
cjc04662  B cell receptor signaling pathway
cjc04664  Fc epsilon RI signaling pathway
cjc04666  Fc gamma R-mediated phagocytosis
cjc04668  TNF signaling pathway
cjc04713  Circadian entrainment
cjc04720  Long-term potentiation
cjc04722  Neurotrophin signaling pathway
cjc04723  Retrograde endocannabinoid signaling
cjc04724  Glutamatergic synapse
cjc04725  Cholinergic synapse
cjc04726  Serotonergic synapse
cjc04730  Long-term depression
cjc04810  Regulation of actin cytoskeleton
cjc04910  Insulin signaling pathway
cjc04912  GnRH signaling pathway
cjc04914  Progesterone-mediated oocyte maturation
cjc04915  Estrogen signaling pathway
cjc04916  Melanogenesis
cjc04917  Prolactin signaling pathway
cjc04919  Thyroid hormone signaling pathway
cjc04921  Oxytocin signaling pathway
cjc04926  Relaxin signaling pathway
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc04929  GnRH secretion
cjc04930  Type II diabetes mellitus
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc04934  Cushing syndrome
cjc04935  Growth hormone synthesis, secretion and action
cjc04960  Aldosterone-regulated sodium reabsorption
cjc05010  Alzheimer disease
cjc05020  Prion disease
cjc05022  Pathways of neurodegeneration - multiple diseases
cjc05034  Alcoholism
cjc05132  Salmonella infection
cjc05133  Pertussis
cjc05135  Yersinia infection
cjc05140  Leishmaniasis
cjc05142  Chagas disease
cjc05145  Toxoplasmosis
cjc05152  Tuberculosis
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05163  Human cytomegalovirus infection
cjc05164  Influenza A
cjc05165  Human papillomavirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05171  Coronavirus disease - COVID-19
cjc05200  Pathways in cancer
cjc05203  Viral carcinogenesis
cjc05205  Proteoglycans in cancer
cjc05206  MicroRNAs in cancer
cjc05207  Chemical carcinogenesis - receptor activation
cjc05208  Chemical carcinogenesis - reactive oxygen species
cjc05210  Colorectal cancer
cjc05211  Renal cell carcinoma
cjc05212  Pancreatic cancer
cjc05213  Endometrial cancer
cjc05214  Glioma
cjc05215  Prostate cancer
cjc05216  Thyroid cancer
cjc05218  Melanoma
cjc05219  Bladder cancer
cjc05220  Chronic myeloid leukemia
cjc05221  Acute myeloid leukemia
cjc05223  Non-small cell lung cancer
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
cjc05230  Central carbon metabolism in cancer
cjc05231  Choline metabolism in cancer
cjc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cjc05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100404815 (MAPK3)
   04012 ErbB signaling pathway
    100404815 (MAPK3)
   04014 Ras signaling pathway
    100404815 (MAPK3)
   04015 Rap1 signaling pathway
    100404815 (MAPK3)
   04350 TGF-beta signaling pathway
    100404815 (MAPK3)
   04370 VEGF signaling pathway
    100404815 (MAPK3)
   04371 Apelin signaling pathway
    100404815 (MAPK3)
   04668 TNF signaling pathway
    100404815 (MAPK3)
   04066 HIF-1 signaling pathway
    100404815 (MAPK3)
   04068 FoxO signaling pathway
    100404815 (MAPK3)
   04072 Phospholipase D signaling pathway
    100404815 (MAPK3)
   04071 Sphingolipid signaling pathway
    100404815 (MAPK3)
   04024 cAMP signaling pathway
    100404815 (MAPK3)
   04022 cGMP-PKG signaling pathway
    100404815 (MAPK3)
   04151 PI3K-Akt signaling pathway
    100404815 (MAPK3)
   04150 mTOR signaling pathway
    100404815 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100404815 (MAPK3)
   04148 Efferocytosis
    100404815 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100404815 (MAPK3)
   04210 Apoptosis
    100404815 (MAPK3)
   04218 Cellular senescence
    100404815 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100404815 (MAPK3)
   04520 Adherens junction
    100404815 (MAPK3)
   04540 Gap junction
    100404815 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    100404815 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100404815 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100404815 (MAPK3)
   04613 Neutrophil extracellular trap formation
    100404815 (MAPK3)
   04620 Toll-like receptor signaling pathway
    100404815 (MAPK3)
   04621 NOD-like receptor signaling pathway
    100404815 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    100404815 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    100404815 (MAPK3)
   04660 T cell receptor signaling pathway
    100404815 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    100404815 (MAPK3)
   04659 Th17 cell differentiation
    100404815 (MAPK3)
   04657 IL-17 signaling pathway
    100404815 (MAPK3)
   04662 B cell receptor signaling pathway
    100404815 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    100404815 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    100404815 (MAPK3)
   04062 Chemokine signaling pathway
    100404815 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100404815 (MAPK3)
   04929 GnRH secretion
    100404815 (MAPK3)
   04912 GnRH signaling pathway
    100404815 (MAPK3)
   04915 Estrogen signaling pathway
    100404815 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    100404815 (MAPK3)
   04917 Prolactin signaling pathway
    100404815 (MAPK3)
   04921 Oxytocin signaling pathway
    100404815 (MAPK3)
   04926 Relaxin signaling pathway
    100404815 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    100404815 (MAPK3)
   04919 Thyroid hormone signaling pathway
    100404815 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    100404815 (MAPK3)
   04916 Melanogenesis
    100404815 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100404815 (MAPK3)
   04270 Vascular smooth muscle contraction
    100404815 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100404815 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    100404815 (MAPK3)
   04725 Cholinergic synapse
    100404815 (MAPK3)
   04726 Serotonergic synapse
    100404815 (MAPK3)
   04720 Long-term potentiation
    100404815 (MAPK3)
   04730 Long-term depression
    100404815 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    100404815 (MAPK3)
   04722 Neurotrophin signaling pathway
    100404815 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    100404815 (MAPK3)
   04380 Osteoclast differentiation
    100404815 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100404815 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100404815 (MAPK3)
   05206 MicroRNAs in cancer
    100404815 (MAPK3)
   05205 Proteoglycans in cancer
    100404815 (MAPK3)
   05207 Chemical carcinogenesis - receptor activation
    100404815 (MAPK3)
   05208 Chemical carcinogenesis - reactive oxygen species
    100404815 (MAPK3)
   05203 Viral carcinogenesis
    100404815 (MAPK3)
   05230 Central carbon metabolism in cancer
    100404815 (MAPK3)
   05231 Choline metabolism in cancer
    100404815 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100404815 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100404815 (MAPK3)
   05212 Pancreatic cancer
    100404815 (MAPK3)
   05225 Hepatocellular carcinoma
    100404815 (MAPK3)
   05226 Gastric cancer
    100404815 (MAPK3)
   05214 Glioma
    100404815 (MAPK3)
   05216 Thyroid cancer
    100404815 (MAPK3)
   05221 Acute myeloid leukemia
    100404815 (MAPK3)
   05220 Chronic myeloid leukemia
    100404815 (MAPK3)
   05218 Melanoma
    100404815 (MAPK3)
   05211 Renal cell carcinoma
    100404815 (MAPK3)
   05219 Bladder cancer
    100404815 (MAPK3)
   05215 Prostate cancer
    100404815 (MAPK3)
   05213 Endometrial cancer
    100404815 (MAPK3)
   05224 Breast cancer
    100404815 (MAPK3)
   05223 Non-small cell lung cancer
    100404815 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100404815 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    100404815 (MAPK3)
   05161 Hepatitis B
    100404815 (MAPK3)
   05160 Hepatitis C
    100404815 (MAPK3)
   05171 Coronavirus disease - COVID-19
    100404815 (MAPK3)
   05164 Influenza A
    100404815 (MAPK3)
   05163 Human cytomegalovirus infection
    100404815 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100404815 (MAPK3)
   05165 Human papillomavirus infection
    100404815 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100404815 (MAPK3)
   05135 Yersinia infection
    100404815 (MAPK3)
   05133 Pertussis
    100404815 (MAPK3)
   05152 Tuberculosis
    100404815 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100404815 (MAPK3)
   05140 Leishmaniasis
    100404815 (MAPK3)
   05142 Chagas disease
    100404815 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100404815 (MAPK3)
   05020 Prion disease
    100404815 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    100404815 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    100404815 (MAPK3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100404815 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100404815 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100404815 (MAPK3)
   04934 Cushing syndrome
    100404815 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100404815 (MAPK3)
   01524 Platinum drug resistance
    100404815 (MAPK3)
   01522 Endocrine resistance
    100404815 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100404815 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cjc03036]
    100404815 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100404815 (MAPK3)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100404815 (MAPK3)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100404815 (MAPK3)
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     100404815 (MAPK3)
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100404815 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase Kdo FTA2
Other DBs
NCBI-GeneID: 100404815
NCBI-ProteinID: XP_035123230
Ensembl: ENSCJAG00000006770
UniProt: A0A2R8MEW2
Position
12:27200721..27209722
AA seq 382 aa
MAAAAAAAAQGGGGGEPRRAEGVGPGVPGEVEMVKGQPFDVGPRYTQLQYIGEGAYGMVS
SAYDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRASTLEAMRD
VYIVQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTT
CDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAE
MLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFP
KSDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDDLPK
ERLKELIFQETARFQPGALEAP
NT seq 1149 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggcggcggctcaggggggcgggggcggggagccccggagagcc
gagggggtcggcccgggggtcccgggggaagtggaaatggtgaaggggcagccgttcgac
gtgggcccgcgctacacgcagctgcagtacatcggcgagggcgcttacggcatggtcagc
tcggcctatgaccacgtgcgcaagactcgagtggccatcaagaagatcagccccttcgag
catcagacctactgccagcgcacgctccgggagatccagatcctgctgcgctttcgccat
gagaatgtcatcggcatccgagacattcttcgggcgtccaccctggaagccatgagggat
gtctacattgtgcaggacctaatggaaactgacctgtacaagttgcttaaaagccagcag
ctgagcaatgaccacatctgctacttcctctaccagatcctgcggggcctcaagtacatc
cactccgccaatgtcctccaccgggatctaaagccctccaacctgctcatcaacaccacc
tgcgaccttaagatctgtgatttcggcctggcccggattgctgatcctgagcacgaccac
actggcttcctgacagagtatgtggctacacgctggtaccgggccccagagatcatgctg
aactccaagggctataccaagtccatcgacatctggtctgtgggctgcattctggctgag
atgctctccaaccggcccatcttccctggcaagcactacctggatcagctcaaccacatt
ctgggcatcctgggctccccatcccaggaggacctgaattgtatcatcaacatgaaggcc
cgaaactacctacagtctctgccctccaagaccaaggtggcctgggccaagcttttcccc
aagtcggactccaaagcccttgacctgctggaccggatgttaacctttaaccccaacaaa
cggatcacagtggaggaagcgctggcccacccctacctggagcagtactatgacccaacg
gatgagccagtggccgaggagcccttcaccttcgacatggagctggatgacctacccaag
gagcggctgaaggagctcatcttccaagagacagcacgcttccagcctggggcgctggag
gccccctaa

DBGET integrated database retrieval system