KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100404850Help
Entry
100404850         CDS       T03264                                 

Gene name
FASLG
Definition
(RefSeq) Fas ligand
  KO
K04389  tumor necrosis factor ligand superfamily member 6
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01524  Platinum drug resistance
cjc04010  MAPK signaling pathway
cjc04014  Ras signaling pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04068  FoxO signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc04210  Apoptosis
cjc04217  Necroptosis
cjc04650  Natural killer cell mediated cytotoxicity
cjc04722  Neurotrophin signaling pathway
cjc04932  Non-alcoholic fatty liver disease (NAFLD)
cjc04940  Type I diabetes mellitus
cjc05142  Chagas disease (American trypanosomiasis)
cjc05143  African trypanosomiasis
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05162  Measles
cjc05163  Human cytomegalovirus infection
cjc05164  Influenza A
cjc05165  Human papillomavirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05320  Autoimmune thyroid disease
cjc05330  Allograft rejection
cjc05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100404850 (FASLG)
   04010 MAPK signaling pathway
    100404850 (FASLG)
   04068 FoxO signaling pathway
    100404850 (FASLG)
   04151 PI3K-Akt signaling pathway
    100404850 (FASLG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100404850 (FASLG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100404850 (FASLG)
   04217 Necroptosis
    100404850 (FASLG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100404850 (FASLG)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100404850 (FASLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100404850 (FASLG)
   05205 Proteoglycans in cancer
    100404850 (FASLG)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100404850 (FASLG)
   05330 Allograft rejection
    100404850 (FASLG)
   05332 Graft-versus-host disease
    100404850 (FASLG)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100404850 (FASLG)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100404850 (FASLG)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100404850 (FASLG)
   05162 Measles
    100404850 (FASLG)
   05164 Influenza A
    100404850 (FASLG)
   05161 Hepatitis B
    100404850 (FASLG)
   05160 Hepatitis C
    100404850 (FASLG)
   05168 Herpes simplex virus 1 infection
    100404850 (FASLG)
   05163 Human cytomegalovirus infection
    100404850 (FASLG)
   05165 Human papillomavirus infection
    100404850 (FASLG)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    100404850 (FASLG)
   05143 African trypanosomiasis
    100404850 (FASLG)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100404850 (FASLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100404850 (FASLG)
   04052 Cytokines and growth factors [BR:cjc04052]
    100404850 (FASLG)
   04090 CD molecules [BR:cjc04090]
    100404850 (FASLG)
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100404850 (FASLG)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Tumor necrosis fators
   100404850 (FASLG)
CD molecules [BR:cjc04090]
 Proteins
  100404850 (FASLG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF GutM TarH
Motif
Other DBs
NCBI-GeneID: 100404850
NCBI-ProteinID: XP_002760408
Ensembl: ENSCJAG00000009396
UniProt: F7I0V8
Position
18
AA seq 280 aa AA seqDB search
MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPP
PLPPLPLPPLKKGGTHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESASQR
HAVSSVEKQIGHPSPPPERKELRKVAHLTGKPNSRSMPLEWEDTYGIVLLSGVKYKKGGL
VINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTAGQMWAR
SSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgcagcagcccttcaattacccatatccccagatctactgggtggacagcagtgccagc
tctccctgggcccctccaggcacagtgcttccctgtccaacctctgtgcccagaaggcct
ggccaaaggagaccaccgccgccgccaccaccgccgccactaccacctccaccaccgcca
ccattgcctccattaccactgccacccctgaagaagggagggacccacagcacaggcctg
tgtctccttgtgatgtttttcatggttctggttgccttggtaggattgggactggggatg
tttcagctcttccaccttcagaaggagctggcagaactccgagagtctgccagccagagg
catgcagtatcgtctgtggagaagcaaataggccaccctagtccaccccctgaaagaaag
gagctgaggaaagtggcccatttaacaggcaagcccaactcaaggtccatgcctctggaa
tgggaagacacctatggaattgtcctgctttctggagtgaagtataagaagggtggcctt
gtgatcaatgaaactgggctgtattttgtatattccaaagtatactttcggggtcagtct
tgcaacaacctgcccctgagtcacaaggtctacatgaggaactctaagtatccccaggat
ctggtgatgatggaggggaagatgatgagctactgcactgctgggcagatgtgggcccgc
agcagctacctgggtgcagtgttcaatcttaccagtgctgatcatttatatgtcaatgta
tctgagctctctctggtcaattttgaggaatctcagacattttttggcttatataagctc
taa

DBGET integrated database retrieval system