KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100405019Help
Entry
100405019         CDS       T03264                                 

Gene name
NOS3, eNOS
Definition
(RefSeq) nitric oxide synthase 3
  KO
K13242  nitric-oxide synthase, endothelial [EC:1.14.13.39]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00220  Arginine biosynthesis
cjc00330  Arginine and proline metabolism
cjc01100  Metabolic pathways
cjc04020  Calcium signaling pathway
cjc04022  cGMP-PKG signaling pathway
cjc04066  HIF-1 signaling pathway
cjc04071  Sphingolipid signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc04370  VEGF signaling pathway
cjc04371  Apelin signaling pathway
cjc04611  Platelet activation
cjc04915  Estrogen signaling pathway
cjc04921  Oxytocin signaling pathway
cjc04926  Relaxin signaling pathway
cjc04931  Insulin resistance
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    100405019 (NOS3)
   00330 Arginine and proline metabolism
    100405019 (NOS3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    100405019 (NOS3)
   04371 Apelin signaling pathway
    100405019 (NOS3)
   04066 HIF-1 signaling pathway
    100405019 (NOS3)
   04020 Calcium signaling pathway
    100405019 (NOS3)
   04071 Sphingolipid signaling pathway
    100405019 (NOS3)
   04022 cGMP-PKG signaling pathway
    100405019 (NOS3)
   04151 PI3K-Akt signaling pathway
    100405019 (NOS3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100405019 (NOS3)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100405019 (NOS3)
   04921 Oxytocin signaling pathway
    100405019 (NOS3)
   04926 Relaxin signaling pathway
    100405019 (NOS3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100405019 (NOS3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100405019 (NOS3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100405019 (NOS3)
Enzymes [BR:cjc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     100405019 (NOS3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 HTH_15
Motif
Other DBs
NCBI-GeneID: 100405019
NCBI-ProteinID: XP_009001077
Position
8
AA seq 997 aa AA seqDB search
MFTYICNHIKYATNRGNLRSAITVFPQRCPGRGDFRIWNSQLVRYAGYRQQDGSVRGDPA
NVEITELCIQHGWTPGSGRFDVLPLLLQAPDEPPELFLLPPELVLEVPLEHPTLEWFAAL
GLRWYALPAVSNMLLEIGGLEFPAAPFSGWYMSTEIGTRNLCDPHRYNILEDVAVCMDLD
TRTTSSLWKDKAAVEINVAVLHSYQLAKVTIVDHHAATASFMKHLENEQKARGGCPADWA
WIVPPISGSLTPVFHQEMVNYFLSPAFRYQPDPWKGSAAKGTGITRKKTFKEVANAVKIS
ASLMGTVMARRVKATVLYGSETGRAQGYAQQLGRLFRKAFDPRVLCMDEYDVVSLEHETL
VLVVTSTFGNGDPPENGESFAAALMEMSGPYNSSPRPEQHKSYKIRFNSVSCSDPLVSSW
RRKRKESSNTDSAGALGTLRFCVFGLGSRAYPHFCAFARAVDTRLEELGGERLLQLGQGD
ELCGQEEAFRGWAQAAFQAACETFCVGEDAKAAARDVFSPKRSWKRQRYRLSTQAEGLQL
LPGLIHVHRRKMFQATILSVENLQSSKSTRATILVRLDTGGQEGLQYQPGDHIGICPPNR
PGLVEALLSRVEDPPAPTEPVAVEQLEKGSPGGPPPGWVRDPRLPPCTLRQALTFFLDIT
SPPSPQLLRLLSTLAEEPREQQELEALSQDPRRYEEWKWIRCPTLLEVLEQFPSVALPAP
LLLTQLHLLQPRYYSVSSAPSIHPGEIHITVAVLAYRTQDGLGPLHYGVCSTWLSQLKPG
DPVPCFIRGAPSFRLPPDPSLPCILVGPGTGIAPFRGFWQERLHDIESKGLQPAPMTLVF
GCRCSQLDHLYRDEVHDAQQRGVFGRVLTAFSREPDNPKTYVQDILRTELAAEVHRVLCL
ERGHMFVCGDVTMATNVLQTVQRILATEGDLELEEAGDVIGVLRDQQRYHEDIFGLTLRT
QEVTSRIRTQSFSLQERQLRGAVPWAFDPPTSDTNGP
NT seq 2994 nt NT seq  +upstreamnt  +downstreamnt
atgttcacctacatctgcaaccacatcaagtatgccaccaaccggggcaaccttcgctca
gccatcacagtgttccctcagcgctgccctggccgcggagactttcgaatctggaacagc
cagctggtgcgctacgcaggctaccggcagcaggacggctccgtgcggggggacccggcc
aacgtggagatcactgagctctgcatccagcacggctggaccccaggaagtggccgcttc
gacgtgctgccgctgctgctgcaggccccagacgagcccccagaactcttccttctgccc
ccagagctggtccttgaggtgcccctggagcaccccacgctggagtggtttgcagccctg
ggcctgcgctggtatgccctcccggcggtctccaacatgctgctggaaattgggggtctg
gagttccctgcagcccccttcagtggctggtacatgagcactgagattggcaccaggaac
ctgtgtgacccccaccgctacaacatcctggaggacgtggctgtctgcatggacctggat
acccggacgacctcgtccctgtggaaagacaaggcggcggtggaaatcaacgtggctgtg
ctgcacagttaccagctggccaaagtgaccatcgtggaccaccacgctgccacagcttcc
ttcatgaaacacctggagaatgagcagaaggccagggggggctgccctgcagactgggcc
tggatcgtgccccccatctcaggcagcctcactcctgtcttccatcaggagatggtcaac
tatttcctgtcccctgccttccgctaccagccagacccctggaaggggagtgcagccaag
ggcaccggcatcaccaggaagaagacctttaaggaagtggccaacgccgtgaagatctcc
gcctcgctcatgggcaccgtgatggctaggcgggtgaaggcaacagtcctgtacggctct
gagaccggccgggcccagggctacgcacagcagttggggagactcttccggaaggctttt
gacccccgggtcctgtgtatggatgagtatgacgtggtgtccctggaacacgagacactg
gtgctggtggtaaccagcacatttgggaatggcgatcccccggagaatggagagagcttt
gcagctgccctgatggagatgtccggcccttacaacagctccccgaggccagagcagcac
aagagttacaagatccgcttcaacagcgtctcctgctcagacccactggtgtcctcgtgg
cggcggaagaggaaggagtccagtaacacagacagtgcaggggccctgggcaccctcagg
ttctgtgtgttcgggctgggctcccgggcgtacccccacttctgcgcctttgctcgagcg
gtagacacgcggctggaggaactgggaggggagcggctgctgcagctgggccagggcgac
gagctgtgtggccaggaggaagccttccgaggctgggcccaggctgccttccaggccgcc
tgtgagaccttctgtgtgggagaggatgccaaagctgccgcccgagatgtcttcagcccc
aaacgcagctggaagcgccagaggtaccggctgagcacccaggccgagggcctgcagctg
ctgccaggtctgatccacgtgcacaggcggaagatgttccaggctacaatcctttcagtg
gaaaacctgcaaagcagcaagtccacgcgggccaccatcctggtgcgcctggacaccgga
ggccaggaggggctgcagtaccagccaggggaccacataggcatctgcccacccaaccgg
cctggccttgtggaggcgctgctgagccgcgtggaggacccgccagcacccactgagccc
gtggcagtagagcagctggagaagggcagccctggtggccctccccccggctgggtgcgg
gacccccggctgcccccgtgcacactgcgccaggctctcaccttcttcctggacattacc
tccccacccagtcctcagctcttgcggctgctcagcactctggcagaagagcccagggaa
cagcaggagctggaggccctcagccaggatccccggcgctacgaggagtggaagtggatc
cgctgccccacgctgctggaggtgctggagcagttcccgtcagtggcactgcctgcccca
ctgctcctcacccagctgcatctgctgcagccccgctactactcagtcagctcagcacct
agcatccacccaggagagatccacatcacagtagctgtgctggcatacaggacccaggat
gggctgggccccctgcactatggagtctgctccacgtggctaagccaactcaagcctgga
gaccctgtgccctgcttcatccggggggctccctccttccggctgccgcccgatcccagc
ctcccctgcatcctggtgggcccaggcactggcattgcccccttccggggattctggcag
gagcggctgcatgacatcgagagcaaagggctgcagcctgcccccatgactttggtgttc
ggctgccggtgctcccaacttgaccatctctaccgcgacgaggtgcacgacgcccagcag
cgcggggtgtttggccgagtcctcaccgccttctcccgggaacccgacaatcccaagacc
tacgtgcaggacatcctaaggacggagctggctgcggaggtgcaccgcgttctgtgcctt
gagcggggccacatgtttgtctgcggcgatgtcaccatggcaaccaacgtcctgcagacc
gtgcagcgcatcctggcgaccgagggcgacttggagctggaagaggccggcgacgtcatt
ggcgtgctgcgggatcagcaacgctaccacgaagacatttttgggctcacgctgcgcacc
caggaggtgacaagccgcatacgcacccagagtttttccttgcaggagcggcagttgcgg
ggcgcagtaccctgggcgttcgacccgcccacctcagacaccaatggcccttga

DBGET integrated database retrieval system