KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100405335Help
Entry
100405335         CDS       T03264                                 

Gene name
BECN2
Definition
(RefSeq) beclin 2
  KO
K08334  beclin
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04136  Autophagy - other
cjc04137  Mitophagy - animal
cjc04140  Autophagy - animal
cjc04215  Apoptosis - multiple species
cjc04371  Apelin signaling pathway
cjc05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100405335 (BECN2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100405335 (BECN2)
   04136 Autophagy - other
    100405335 (BECN2)
   04137 Mitophagy - animal
    100405335 (BECN2)
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    100405335 (BECN2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100405335 (BECN2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100405335 (BECN2)
   03029 Mitochondrial biogenesis [BR:cjc03029]
    100405335 (BECN2)
Membrane trafficking [BR:cjc04131]
 Autophagy
  Autophagosome formation proteins
   PI3K complex
    100405335 (BECN2)
Mitochondrial biogenesis [BR:cjc03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    100405335 (BECN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: APG6 APG6_N GAS DUF773 DUF743 BH3 CENP-F_leu_zip Spc7 BRE1 HAUS5
Motif
Other DBs
NCBI-GeneID: 100405335
NCBI-ProteinID: XP_008983986
Position
19
AA seq 500 aa AA seqDB search
MSSIRFLCQRCNQALKLSCSSESGVFPAASALTSGQAEPRDTQEPCTTREVTDAEEPQDG
ASSPPLPGDGCVSSYSASIFTLLGKLGPMRMLSSIQKAAGDIFDIISGQEDVDHPLCEEC
TDSLLEQLDFQLALTEGERQNYQRCLESGELETSEKEVEALRAELRDLELQEARLAQELE
DADSNRARAAADLEAAQAETAELGQQERQCSRDCSALEYQQLELLDQLGHLENQLQYARV
QLDRLEEINCFNATFEVWVEGPLGVINNFRLGCLPTVPVSWNEINAAWGQAALLLLALAN
TVGLEFQRYRLMPCGNHSYLKSLTDDRMELPLFCHGGQDVFFDNKFDRAMVAFLDLMQQF
KEEAEKGESGLCLPYGIQVENGLMEDTGGLRKCYSIRTHLNTQELWTKALKFMLINFKWS
LTWVASRPPDTGPKKAEEKFSLLNNSNGSLDQSHRHVAALRIGYTAPWLPYHCENTLQQK
MTTRIIRHSLYLQPVERHDR
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccatccgcttcctgtgccagcgctgcaaccaggccctgaagctgagctgctcc
tctgagtccggggtcttccctgcagcttcggccctcacctccgggcaggctgagcccaga
gacacccaggagccctgcaccaccagggaggtgacagacgctgaagagccgcaggacggt
gcctccagcccaccccttccaggggatggctgtgtgtccagctacagtgccagcatcttc
accctgctggggaagcttggccccatgcggatgctcagcagcatccagaaggcagctggt
gacatttttgacatcatctctggccaagaagatgtggaccatcccctgtgtgaagagtgc
accgacagtcttctagagcagttggacttccagctcgctcttaccgaaggtgagagacag
aactaccaacgctgcctggagagcggggagctggagaccagcgagaaggaggtggaggct
ctgcgggcggagctgcgggacctggagctgcaggaggccaggctggcccaggagctggag
gacgcggatagcaaccgtgcgagagcagccgcggacctcgaggcagcccaggcagagact
gcggagctgggccagcaggagaggcagtgctccagggactgcagtgccttggagtaccag
cagctggaactgctggaccagctggggcacctggagaaccagctgcagtatgccagggtc
cagctcgaccggctggaggaaatcaactgcttcaatgccacatttgaggtctgggtggag
ggccccttgggcgtcatcaataacttcaggttgggctgcctccccactgtccctgtgagc
tggaatgagattaatgctgcctggggacaggcggctttgctgctccttgccctggccaat
acagttggtctggagtttcagaggtatcgactcatgccctgtggaaaccattcctatctc
aagtctttgacagatgaccgcatggagctgcctttgttctgtcatggggggcaggatgtt
ttcttcgataataagtttgaccgcgccatggtggccttcctggacctcatgcagcagttc
aaggaagaggctgagaagggtgagtccggcctctgtctgccctatgggatccaggtggag
aatggcctgatggaagacactggtggcctcaggaaatgctattccatcagaacccatctg
aacacgcaggagctgtggacaaaggccctcaagttcatgctcataaacttcaagtggagt
ctcacctgggttgcctcaaggcccccagacactggacctaagaaagcagaggaaaagttt
tccctccttaataacagtaatgggagcctagatcaatcacaccgccacgtggctgctctg
agaatcggatacacagccccctggcttccataccactgtgaaaacactttgcaacagaaa
atgaccaccaggattattcgccattctctgtacctgcagcctgtggagaggcatgatcgg
tga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100413058Help
Entry
100413058         CDS       T03264                                 

Gene name
BECN1, beclin-1
Definition
(RefSeq) beclin 1
  KO
K08334  beclin
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04136  Autophagy - other
cjc04137  Mitophagy - animal
cjc04140  Autophagy - animal
cjc04215  Apoptosis - multiple species
cjc04371  Apelin signaling pathway
cjc05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100413058 (BECN1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100413058 (BECN1)
   04136 Autophagy - other
    100413058 (BECN1)
   04137 Mitophagy - animal
    100413058 (BECN1)
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    100413058 (BECN1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100413058 (BECN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100413058 (BECN1)
   03029 Mitochondrial biogenesis [BR:cjc03029]
    100413058 (BECN1)
Membrane trafficking [BR:cjc04131]
 Autophagy
  Autophagosome formation proteins
   PI3K complex
    100413058 (BECN1)
Mitochondrial biogenesis [BR:cjc03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    100413058 (BECN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: APG6 APG6_N BH3 MT HAUS-augmin3 LMBR1 Exonuc_VII_L EzrA ERM PI_PP_I Suppressor_APC
Motif
Other DBs
NCBI-GeneID: 100413058
NCBI-ProteinID: XP_002748048
Ensembl: ENSCJAG00000013144
UniProt: U3BN92
Position
5
AA seq 450 aa AA seqDB search
MEGSKTSNNSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEE
ETNSGEEPFIETPRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTG
DLFDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQL
QMELKELALEEERLIQELEDVEKNRQMVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQ
LELDDELKSVENQMRYAQLQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEW
NEINAAWGQTVLLLHALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELPLYCSGGLRFF
WDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFN
SEEQWTKALKFMLTNLKWGLAWVSSQFYNK
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atggaagggtctaagacgtccaacaacagcaccatgcaggtgagcttcgtgtgccagcgc
tgcagccagcccctgaaactggacacgagtttcaagatcctggatcgtgtcaccatccag
gaactcacagctccattacttaccacagcccaggcgaaaccaggagagacccaggaggaa
gagactaactcaggagaggagccatttattgaaactcctcgccaggatggtgtctctcgc
agattcatccccccagccaggatgatgtccacagaaagcgccaacagcttcactctgatt
ggggaggcatctgatggcggcaccatggagaacctcagccgaagactgaaggtcactggg
gacctttttgacatcatgtcgggccagacagatgtggatcacccactctgtgaggaatgc
acagatactcttttagaccagctggacactcagctcaacgtcactgaaaatgaatgtcag
aactacaaacgctgtttggagatcttagagcaaatgaatgaagatgacagtgaacagctt
cagatggagctaaaagagctggcactagaggaggagaggctgatccaggagctggaagat
gtggaaaagaaccgccagatggtggcagaaaatcttgagaaggtccaggctgaggctgag
agactggatcaggaggaagctcagtatcagagagaatacagtgaatttaaacgacaacag
ctggagctggatgatgagctgaagagtgttgaaaaccagatgcgttatgcccagttgcag
ctggacaagctgaagaaaaccaacgtttttaatgcaactttccacatctggcacagtgga
cagtttggcacaatcaataacttcaggctgggtcgcctgcccagtgttccagtggaatgg
aatgagattaatgctgcttggggccaaactgtgttgctgctccatgctctggccaataag
atgggtctgaaatttcagaggtatcgacttgttccttatggaaaccattcatatctggag
tctctgacagacaaatctaaggagctgccgttatactgttctggggggttgcggtttttc
tgggacaacaagtttgaccatgcaatggtggctttcctggactgtgtgcaacagttcaaa
gaagaggttgagaaaggcgagacacgtttttgtcttccctacaggatggatgtggagaaa
ggcaagattgaagacacaggaggcagcggcggctcctattccatcaaaacccagtttaac
tctgaggagcagtggacaaaagctctcaagttcatgctgacgaatcttaagtggggtctt
gcttgggtatcctcacaattttataacaaatga

DBGET integrated database retrieval system