KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100405343Help
Entry
100405343         CDS       T03264                                 

Gene name
TICAM1
Definition
(RefSeq) toll like receptor adaptor molecule 1
  KO
K05842  toll-like receptor adapter molecule 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04064  NF-kappa B signaling pathway
cjc04217  Necroptosis
cjc04620  Toll-like receptor signaling pathway
cjc04621  NOD-like receptor signaling pathway
cjc05133  Pertussis
cjc05142  Chagas disease (American trypanosomiasis)
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05164  Influenza A
cjc05165  Human papillomavirus infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100405343 (TICAM1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100405343 (TICAM1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100405343 (TICAM1)
   04621 NOD-like receptor signaling pathway
    100405343 (TICAM1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100405343 (TICAM1)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100405343 (TICAM1)
  09172 Infectious disease: viral
   05164 Influenza A
    100405343 (TICAM1)
   05161 Hepatitis B
    100405343 (TICAM1)
   05160 Hepatitis C
    100405343 (TICAM1)
   05168 Herpes simplex virus 1 infection
    100405343 (TICAM1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100405343 (TICAM1)
   05165 Human papillomavirus infection
    100405343 (TICAM1)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    100405343 (TICAM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRIF-NTD RHIM TIR_2
Motif
Other DBs
NCBI-GeneID: 100405343
NCBI-ProteinID: XP_002761653
UniProt: U3F0S9
Position
22
AA seq 697 aa AA seqDB search
MACKGPSLPSAFDILGTAGEEKLLYLKHKLKTLRPGCQGRDLLHAMVLLKLGQETEARIS
LEALKADAAAQLVARQWAGVDSTEDPEEPPDVSWTVARLYHLLAEEKLCPASQRDEAYRE
ALRTLSARDDHRLGELQDEARDRCGWDVAGDPGSIQTLQSNLGCLPQSSASPSGTRSLPR
PIDGVSGWSQGRSLRSTGSPASLTSNLEISQSPTMPLLSLHRSPQGPSKLCDDPQASKVP
EPVPGGCQEPEEMSWPPSGEIASPPELPSSPPPGFCKVAPDATSTGLLDTPEAPETSTQF
PVECTEGSAGPQSLPLPILEPPQNPCPVKGQTSPQLSVEDTTSPNTKPSPSPTTPKTSHP
PPPPPSAPSSAHLAPSSLFPSSLESSSEQKFYNFVILHARADEHIALRVREKLEALGVPD
GATFCEDFQVPGRGELRCLQDAIDHSAFIILLLTSNFDCHLSLHQVNQALVSNLMRQGPS
DCVIPFLPLESSLAELSSDTASLLSGLVRLDEHSRIFDKKVANTFTSYRLQARKAMWRKE
QDTRALREQSQHLDSERVQVAAMNAAYSAYLRSYLSWQAQMEQLQAAFGSHMSFGTGAPF
GAQMPFGGQVPLGAPPPFPTGLGYPQPPPLHGWQVGTPLPPFPQPSGFPTASPAPPQSPG
LQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDSTQEAE
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atggcctgcaagggcccgtcacttcccagcgccttcgacatcctgggcacagcgggcgag
gaaaagctcttgtatctgaagcacaaactgaagactctgcgcccaggctgccaggggcgg
gacctcctgcacgccatggtgctgctgaagctgggccaggagaccgaggccaggatctct
ctagaggcactgaaggctgatgccgcggctcagctagtagcccgccagtgggctggtgtg
gacagcactgaggacccagaggagcccccggacgtatcctggactgtggcccgcttgtac
cacctgctggctgaggagaagctgtgcccggcttcgcagcgggatgaggcctaccgggaa
gccctccggactctcagcgccagggacgaccaccggctgggggagctccaggatgaggcc
cgggaccggtgtgggtgggacgtggctggggatccagggagcatccagacactccagtcc
aatctgggctgcctcccacagtcctcagcttcgccctctgggacccggagcctccctcgc
cccatcgatggggtttcaggctggagccaagggcgttccctgaggtcaactggcagcccc
gcctccctgaccagcaacttggaaatcagccagtcgcccacgatgcccctcctcagcttg
caccgcagcccccaggggcccagcaagctctgtgatgaccctcaggccagcaaggtgccc
gagcctgttcctggtggctgccaggagcctgaggagatgagctggccgccctcgggggag
attgccagccccccagagctgccaagcagcccaccccctggattttgcaaagtggcccca
gatgcaacttcgactggcctccttgacacccctgaagctccagaaaccagcacccagttc
ccggtggagtgcaccgaggggtctgcaggcccccagtctctccccttgcccattttggag
cccccccaaaacccctgccctgtcaaaggacagacatcaccccaactttctgtagaagac
accacctctccaaataccaagccaagcccatctcccaccaccccaaaaacatcccatcct
cctcctcctcctccatcagccccctcttcagctcacctggccccctcctccctgttccct
tcctccctggaatcatcatcagagcagaaattctataactttgtgatcctccatgccagg
gcggacgagcacattgccctgcgggtccgggagaagctggaggccctcggtgtgcctgac
ggggccaccttctgtgaggacttccaggtgcccgggcgcggggagctccgctgcctgcag
gatgcaattgaccactctgccttcatcatcctccttctcacctccaacttcgactgccac
ctgagcctgcaccaggtgaaccaagccctggtgagcaacctcatgcgacaggggccgtca
gactgtgtcatccccttcctgcccctggagagctccctggccgagctcagctccgacaca
gccagcctgctctctgggttggtgcggctggacgaacactctcggatctttgacaagaag
gtggccaacaccttcacgtcctacaggcttcaggcccgaaaggccatgtggaggaaggaa
caggacacccgagccctgcgggaacagagccaacacctggacagtgagcgggtgcaggtg
gccgccatgaacgctgcatattcggcctacctccggagctatctgtcctggcaggcacag
atggagcagctccaggcggcttttgggagccacatgtcatttgggactggggcacccttt
ggggctcaaatgccctttggtggccaagtgcctctgggagccccgccaccctttcccact
gggctggggtacccgcagcctccacccctgcacgggtggcaggttggtactcccctaccg
cccttcccacaaccctcaggcttccctacagcctcacctgcgccccctcagagcccggga
ttgcaacccctcattatccaccatgcgcagatggtacagctggggctgaacaaccacatg
tggaaccagagagggtcccaggcacccgaggacagtacacaggaggcagaatga

DBGET integrated database retrieval system