KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100405403Help
Entry
100405403         CDS       T03264                                 

Gene name
ADCY9
Definition
(RefSeq) adenylate cyclase 9
  KO
K08049  adenylate cyclase 9 [EC:4.6.1.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00230  Purine metabolism
cjc01100  Metabolic pathways
cjc01522  Endocrine resistance
cjc04015  Rap1 signaling pathway
cjc04020  Calcium signaling pathway
cjc04022  cGMP-PKG signaling pathway
cjc04024  cAMP signaling pathway
cjc04062  Chemokine signaling pathway
cjc04072  Phospholipase D signaling pathway
cjc04114  Oocyte meiosis
cjc04211  Longevity regulating pathway
cjc04213  Longevity regulating pathway - multiple species
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04270  Vascular smooth muscle contraction
cjc04371  Apelin signaling pathway
cjc04540  Gap junction
cjc04611  Platelet activation
cjc04713  Circadian entrainment
cjc04714  Thermogenesis
cjc04723  Retrograde endocannabinoid signaling
cjc04724  Glutamatergic synapse
cjc04725  Cholinergic synapse
cjc04727  GABAergic synapse
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04911  Insulin secretion
cjc04912  GnRH signaling pathway
cjc04913  Ovarian steroidogenesis
cjc04914  Progesterone-mediated oocyte maturation
cjc04915  Estrogen signaling pathway
cjc04916  Melanogenesis
cjc04918  Thyroid hormone synthesis
cjc04921  Oxytocin signaling pathway
cjc04923  Regulation of lipolysis in adipocytes
cjc04925  Aldosterone synthesis and secretion
cjc04926  Relaxin signaling pathway
cjc04927  Cortisol synthesis and secretion
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc04934  Cushing syndrome
cjc04961  Endocrine and other factor-regulated calcium reabsorption
cjc04962  Vasopressin-regulated water reabsorption
cjc04970  Salivary secretion
cjc04971  Gastric acid secretion
cjc04972  Pancreatic secretion
cjc04976  Bile secretion
cjc05032  Morphine addiction
cjc05163  Human cytomegalovirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05200  Pathways in cancer
cjc05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100405403 (ADCY9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100405403 (ADCY9)
   04371 Apelin signaling pathway
    100405403 (ADCY9)
   04020 Calcium signaling pathway
    100405403 (ADCY9)
   04072 Phospholipase D signaling pathway
    100405403 (ADCY9)
   04024 cAMP signaling pathway
    100405403 (ADCY9)
   04022 cGMP-PKG signaling pathway
    100405403 (ADCY9)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100405403 (ADCY9)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100405403 (ADCY9)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100405403 (ADCY9)
   04062 Chemokine signaling pathway
    100405403 (ADCY9)
  09152 Endocrine system
   04911 Insulin secretion
    100405403 (ADCY9)
   04923 Regulation of lipolysis in adipocytes
    100405403 (ADCY9)
   04912 GnRH signaling pathway
    100405403 (ADCY9)
   04913 Ovarian steroidogenesis
    100405403 (ADCY9)
   04915 Estrogen signaling pathway
    100405403 (ADCY9)
   04914 Progesterone-mediated oocyte maturation
    100405403 (ADCY9)
   04921 Oxytocin signaling pathway
    100405403 (ADCY9)
   04926 Relaxin signaling pathway
    100405403 (ADCY9)
   04918 Thyroid hormone synthesis
    100405403 (ADCY9)
   04928 Parathyroid hormone synthesis, secretion and action
    100405403 (ADCY9)
   04916 Melanogenesis
    100405403 (ADCY9)
   04925 Aldosterone synthesis and secretion
    100405403 (ADCY9)
   04927 Cortisol synthesis and secretion
    100405403 (ADCY9)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100405403 (ADCY9)
   04270 Vascular smooth muscle contraction
    100405403 (ADCY9)
  09154 Digestive system
   04970 Salivary secretion
    100405403 (ADCY9)
   04971 Gastric acid secretion
    100405403 (ADCY9)
   04972 Pancreatic secretion
    100405403 (ADCY9)
   04976 Bile secretion
    100405403 (ADCY9)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100405403 (ADCY9)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100405403 (ADCY9)
  09156 Nervous system
   04724 Glutamatergic synapse
    100405403 (ADCY9)
   04727 GABAergic synapse
    100405403 (ADCY9)
   04725 Cholinergic synapse
    100405403 (ADCY9)
   04723 Retrograde endocannabinoid signaling
    100405403 (ADCY9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100405403 (ADCY9)
  09149 Aging
   04211 Longevity regulating pathway
    100405403 (ADCY9)
   04213 Longevity regulating pathway - multiple species
    100405403 (ADCY9)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100405403 (ADCY9)
   04714 Thermogenesis
    100405403 (ADCY9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100405403 (ADCY9)
  09165 Substance dependence
   05032 Morphine addiction
    100405403 (ADCY9)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    100405403 (ADCY9)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100405403 (ADCY9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100405403 (ADCY9)
   05163 Human cytomegalovirus infection
    100405403 (ADCY9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100405403 (ADCY9)
Enzymes [BR:cjc01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100405403 (ADCY9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc DUF512 DUF1053
Motif
Other DBs
NCBI-GeneID: 100405403
NCBI-ProteinID: XP_002755917
Ensembl: ENSCJAG00000019746
UniProt: F6RS83
Position
12
AA seq 1353 aa AA seqDB search
MASPPHQQLLHHHSTEVSCDSSGDSNSVRVKINPKQLSSNSHPKHCKYSISSSCSSSGDS
GGVPRRVGSGGRLRRQKKLPQLFERASSRWWDPKFDSVNLEEACLERCFPQTQRRFRYAL
FYIGFACLLWSIYFAVHMRSRLIVMVAPALCFLLVCVGFFLFTFTKLYARHYVWTSLALT
LLVFALTLAAQFQVLTPVSGLGDSSNLTAAAQPTDTCLSQVGSFSMCIEVLFLLYTVMHL
PLYLSLCLGVAYSVLFETFGYHFRDEACFPSPGAGALHWELLSRALLHGCIHAIGVHLFV
MSQVRSRSTFLKVGQSIMHGKDLEVEKALKERMIHSVMPRIIADDLMKQGDEESENSVKR
YATSSPKNRKKKSSIQKAPIAFRPFKMQQIEEVSILFADIVGFTKMSANKSAHALVGLLN
DLFGRFDRLCEETKCEKISTLGDCYYCVAGCPEPRADHAYCCIEMGLGMIKAIEQFCQEK
KEMVNMRVGVHTGTVLCGILGMRRFKFDVWSNDVNLANLMEQLGVAGKVHISEATAKYLD
DRYEMEDGKVTERLGQSVVADQLKGLKTYLISGQRAKESPCSCAEALLSGFEVIGGSQVS
SGPRGQGTASSGNVSDLAQTVKTFDNLKTCSSCGITFAPKSEAGAEGGAPQNGCQDEHKN
STKASGGSNPKTQNGLLSPPQEEKLTNSQTSLCEILQEKGRWAGVSLDQSALLPLRFKNI
REKTDAHFVDVIKEDSLMKDYFFKPPINQFSLNFLDQELERSYRSSYQEEVIKNSPVKTF
ASPTFSSLLDVFLSTTVFLTLSITCFLKYGAATAPPPPAALAVFSTALLLEMLSLAVSVR
MVFFLEDVMACTKRLLEWVAGWLPRHCIGAILVSLPALAVYSHVTSEFETNVHFPVFTGS
AALIAVVHYCNFCQLSSWMRSSLATVVGAGPLLLLYASLCPDSSVLTSPLDAVQNFSSER
NPCNSSLPRDLRRPASLIGQEVVLVFFLLLLLVWFLNREFEVSYRLHYHGDVEADLHRTK
IQSMRDQADWLLRNIIPYHVAEQLKVSQTYSKNHDSGGVIFASIVNFSEFYEENYEGGKE
CYRVLNELIGDFDELLSKPDYSSIEKIKTIGATYMAASGLNTAQAQDGSHPQEHLQILFE
FAKEMMRVVDDFNNNMLWFNFKLRIGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTT
GVECRIQVSEESYRVLSKMGYDFDYRGTVNVKGKGQMKTYLYPKCTDHGVIPQHQLSISP
DIRVQVDGSIGRSPTDEIANLVPSVQYADKTSLGSNSGSQAKDAHLSPKRPWKEPIKAEE
GGQFGKAIEKDDCDDTGMEEANELTKLNVSKSV
NT seq 4062 nt NT seq  +upstreamnt  +downstreamnt
atggcttccccgccccaccagcagctgctgcatcaccacagcaccgaggtgagctgcgac
tccagcggggacagcaacagcgtgcgcgtcaagatcaaccccaagcagctgtcctccaac
agccaccccaagcactgcaagtacagcatctcctccagctgcagcagctccggggactcc
gggggtgtcccccggcgagtgggcagcggaggccgccttcgcaggcagaagaagctcccc
cagctgttcgagagggcctccagccgctggtgggaccccaagttcgactcggtaaacctg
gaggaggcctgcctggagcgctgcttcccgcagacccagcgccggttccggtatgcactc
ttctacattggctttgcttgccttctgtggagcatctattttgcggtccacatgagatcc
agactgatcgtcatggtcgcccccgctctgtgcttcctcctggtgtgcgtgggcttcttt
ctgtttaccttcaccaagctgtacgcccggcattacgtgtggacctcgctggccctcacc
ctgctggtgttcgccctgaccctggctgcacagttccaggtcttgacgcctgtctcagga
ctgggcgacagctccaatctgacggctgcagcccagcccacggacacgtgcttatctcaa
gtggggagcttttccatgtgcatcgaagtgctcttcttgctctacaccgtcatgcacttg
cctttgtacttgagcttgtgtctgggggtggcctactctgtccttttcgagacctttggc
taccatttccgggatgaagcctgcttcccctcgcccggagccggggccctgcactgggag
ctgttgagcagggcgctgctccacggttgcatccatgccatcggggtccacctgttcgtc
atgtcccaggtgaggtccaggagcaccttcctcaaggttggacagtccatcatgcacggg
aaggacttggaagtggagaaagcccttaaagagaggatgattcactccgtgatgccaaga
atcatagccgacgacttaatgaagcagggggatgaggagagtgagaattctgtcaagagg
tatgccacctcgagccccaagaataggaagaagaagtcttccatacaaaaagctcctatt
gccttccgcccttttaagatgcagcagatcgaggaagtcagtattttatttgcagatatc
gtgggcttcaccaagatgagtgccaacaagtccgcccacgccctggtgggtctcctgaac
gatctgttcggtcgcttcgaccgcctgtgtgaggagaccaagtgtgagaagatcagcact
ctgggagactgttactactgcgtggcgggctgtcccgagccccgggccgaccatgcctac
tgctgcattgagatggggctgggcatgatcaaggccattgagcagttctgccaggagaag
aaggaaatggtgaacatgcgggtcggggttcacacgggcaccgtcctgtgtggcatcctg
ggcatgaggaggtttaaatttgatgtgtggtccaacgatgtgaacctggccaatctcatg
gagcagctgggggtggccggcaaagttcacatttctgaggccactgcaaaatacttagat
gaccggtacgaaatggaagatgggaaagttacggaacggctgggccagagcgtggttgct
gaccagttgaaaggtttgaagacatacctgatatcgggtcagagagccaaggagtctcct
tgcagctgtgcagaggccttgctttctggctttgaggtcattggcggctcacaggtgtcc
tcaggccctaggggacaggggacagcgtcatcagggaatgtcagtgacttggcgcagact
gtcaaaacctttgataaccttaagacctgctcttcatgcggaatcacatttgctcccaaa
tccgaagccggcgccgagggaggagcacctcaaaacggctgccaagacgagcataaaaac
agcaccaaggcttctggaggatctaatcccaaaactcagaacgggctcctgagccctccc
caggaggagaagctcaccaacagtcagacatctctgtgtgagatcttgcaggagaaggga
aggtgggcaggggtgagcctggaccagtcagctctccttccgctgaggttcaagaatatc
cgggagaaaacggatgcccacttcgtagacgtcatcaaggaagacagcctgatgaaagat
tatttttttaagccacccattaatcagttcagcctgaacttcctggatcaggagctggag
cgatcctacaggagcagctatcaggaagaggtcatcaagaactcccccgtgaagacgttt
gccagtcccaccttcagctccctcctggacgtgtttctgtcgaccacagtgtttctgacg
ctgtccatcacctgcttcctgaagtacggggcggccaccgcacctcccccaccggctgcc
ctggcagtcttcagcacggccctgcttttggagatgctgtccctcgcggtgtccgtcagg
atggtgttcttcctggaggacgtcatggcttgcaccaagcgcctgctggagtgggtcgcc
ggctggttgccgcgtcactgcatcggggccatcctggtgtcgctccctgccctggccgtc
tactcccacgtcacctccgaatttgagacaaacgtacatttcccggtgttcacaggctca
gccgcgctgatcgccgtcgtgcactactgtaacttctgccagctcagctcttggatgagg
tcctcccttgccaccgtcgtgggggccgggccgctgctcctgctctatgcctccctgtgc
ccagacagttctgtattaacttcgccccttgacgccgtacagaatttcagttctgagagg
aacccgtgcaatagctcgctgccgcgtgacctccggcggccggcaagcctcatcggccag
gaggtggttctcgtcttctttctcctgctcttgttggtctggttcctgaaccgcgaattt
gaagtcagctaccgcctccactaccatggggatgtggaagcggacctccaccgcaccaag
atccagagcatgcgggaccaggcggactggctgctgaggaacatcatcccctaccatgtg
gccgagcagctgaaggtttcccagacctactccaagaaccacgacagcggaggggtgatt
ttcgccagcatcgtcaacttcagcgagttctacgaggagaactacgagggtggcaaggag
tgctaccgggtcctcaacgagctcatcggggacttcgacgagctcctaagcaagccggac
tacagcagcatcgagaagatcaagaccatcggagccacgtacatggcggcgtcggggctg
aacaccgcgcaggcacaggacggcagccacccgcaggagcacctgcagatcctgttcgag
ttcgccaaggagatgatgcgcgtggtagacgacttcaacaacaacatgctgtggttcaac
ttcaagctccgcatcggcttcaaccacgggcccctcacggcgggggtcatcggtaccacc
aagctgctgtacgacatctggggggacaccgtcaacatcgccagcaggatggacaccacc
ggcgtggagtgccgcatccaggtgagcgaagagagctaccgcgtcctgagcaagatgggc
tacgacttcgactacagagggaccgtgaacgtcaaggggaaaggccagatgaagacctac
ctgtacccaaagtgcacagaccacggggtcatcccgcagcaccagctgtccatctcccca
gacatccgcgtccaggtggatggcagcatcggacggtctcccacggacgagattgccaac
ctggtgccttctgtccagtatgcggacaagacgtctctgggctccaacagcggctcgcag
gccaaggatgctcacctgtcccccaagagaccctggaaggagcccatcaaagcagaagaa
gggggtcagtttggcaaagccatagagaaagacgactgtgacgacacgggcatggaagaa
gccaatgaactcaccaagctcaacgtttcaaagagtgtgtga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100406617Help
Entry
100406617         CDS       T03264                                 

Gene name
ADCY6
Definition
(RefSeq) adenylate cyclase 6
  KO
K08046  adenylate cyclase 6 [EC:4.6.1.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00230  Purine metabolism
cjc01100  Metabolic pathways
cjc01522  Endocrine resistance
cjc04015  Rap1 signaling pathway
cjc04022  cGMP-PKG signaling pathway
cjc04024  cAMP signaling pathway
cjc04062  Chemokine signaling pathway
cjc04072  Phospholipase D signaling pathway
cjc04114  Oocyte meiosis
cjc04211  Longevity regulating pathway
cjc04213  Longevity regulating pathway - multiple species
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04270  Vascular smooth muscle contraction
cjc04371  Apelin signaling pathway
cjc04540  Gap junction
cjc04611  Platelet activation
cjc04713  Circadian entrainment
cjc04714  Thermogenesis
cjc04723  Retrograde endocannabinoid signaling
cjc04724  Glutamatergic synapse
cjc04725  Cholinergic synapse
cjc04727  GABAergic synapse
cjc04742  Taste transduction
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04911  Insulin secretion
cjc04912  GnRH signaling pathway
cjc04913  Ovarian steroidogenesis
cjc04914  Progesterone-mediated oocyte maturation
cjc04915  Estrogen signaling pathway
cjc04916  Melanogenesis
cjc04918  Thyroid hormone synthesis
cjc04921  Oxytocin signaling pathway
cjc04923  Regulation of lipolysis in adipocytes
cjc04924  Renin secretion
cjc04925  Aldosterone synthesis and secretion
cjc04926  Relaxin signaling pathway
cjc04927  Cortisol synthesis and secretion
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc04934  Cushing syndrome
cjc04961  Endocrine and other factor-regulated calcium reabsorption
cjc04962  Vasopressin-regulated water reabsorption
cjc04970  Salivary secretion
cjc04971  Gastric acid secretion
cjc04972  Pancreatic secretion
cjc04976  Bile secretion
cjc05032  Morphine addiction
cjc05163  Human cytomegalovirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05200  Pathways in cancer
cjc05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100406617 (ADCY6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100406617 (ADCY6)
   04371 Apelin signaling pathway
    100406617 (ADCY6)
   04072 Phospholipase D signaling pathway
    100406617 (ADCY6)
   04024 cAMP signaling pathway
    100406617 (ADCY6)
   04022 cGMP-PKG signaling pathway
    100406617 (ADCY6)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100406617 (ADCY6)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100406617 (ADCY6)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100406617 (ADCY6)
   04062 Chemokine signaling pathway
    100406617 (ADCY6)
  09152 Endocrine system
   04911 Insulin secretion
    100406617 (ADCY6)
   04923 Regulation of lipolysis in adipocytes
    100406617 (ADCY6)
   04912 GnRH signaling pathway
    100406617 (ADCY6)
   04913 Ovarian steroidogenesis
    100406617 (ADCY6)
   04915 Estrogen signaling pathway
    100406617 (ADCY6)
   04914 Progesterone-mediated oocyte maturation
    100406617 (ADCY6)
   04921 Oxytocin signaling pathway
    100406617 (ADCY6)
   04926 Relaxin signaling pathway
    100406617 (ADCY6)
   04918 Thyroid hormone synthesis
    100406617 (ADCY6)
   04928 Parathyroid hormone synthesis, secretion and action
    100406617 (ADCY6)
   04916 Melanogenesis
    100406617 (ADCY6)
   04924 Renin secretion
    100406617 (ADCY6)
   04925 Aldosterone synthesis and secretion
    100406617 (ADCY6)
   04927 Cortisol synthesis and secretion
    100406617 (ADCY6)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100406617 (ADCY6)
   04270 Vascular smooth muscle contraction
    100406617 (ADCY6)
  09154 Digestive system
   04970 Salivary secretion
    100406617 (ADCY6)
   04971 Gastric acid secretion
    100406617 (ADCY6)
   04972 Pancreatic secretion
    100406617 (ADCY6)
   04976 Bile secretion
    100406617 (ADCY6)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100406617 (ADCY6)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100406617 (ADCY6)
  09156 Nervous system
   04724 Glutamatergic synapse
    100406617 (ADCY6)
   04727 GABAergic synapse
    100406617 (ADCY6)
   04725 Cholinergic synapse
    100406617 (ADCY6)
   04723 Retrograde endocannabinoid signaling
    100406617 (ADCY6)
  09157 Sensory system
   04742 Taste transduction
    100406617 (ADCY6)
   04750 Inflammatory mediator regulation of TRP channels
    100406617 (ADCY6)
  09149 Aging
   04211 Longevity regulating pathway
    100406617 (ADCY6)
   04213 Longevity regulating pathway - multiple species
    100406617 (ADCY6)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100406617 (ADCY6)
   04714 Thermogenesis
    100406617 (ADCY6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100406617 (ADCY6)
  09165 Substance dependence
   05032 Morphine addiction
    100406617 (ADCY6)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    100406617 (ADCY6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100406617 (ADCY6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100406617 (ADCY6)
   05163 Human cytomegalovirus infection
    100406617 (ADCY6)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100406617 (ADCY6)
Enzymes [BR:cjc01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100406617 (ADCY6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AC_N Guanylate_cyc DUF1053 HNOBA TBK1_ULD Shisa DUF2339
Motif
Other DBs
NCBI-GeneID: 100406617
NCBI-ProteinID: XP_017831511
Ensembl: ENSCJAG00000020756
Position
9
AA seq 1089 aa AA seqDB search
MELGLRAVALGFEDTDMTPAGGGTAEVAPDAVPRSRRSCWGRLVQVFQSKQFRSAKLERL
YQRYFFQMNQSSLTLLMAVLVLLTAVLLAFHAAPARPQPAYVALLACAAALFVALMVVCN
RHSFRQDSMWVVSYVVLGILAAVQVGGALAADPHSPSAGLWCPVFFVYIAYTLLPIRMRA
AVLSGLGLSTLHLILAWQLNRSDAFLWKQLSANVLLFLCTNVIGICTHYPAEVSQRQAFQ
ETRGYIQARLHLQHENRQQERLLLSVLPQHVAMEMKEDINTKKEDMMFHKIYIQKHDNVS
ILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEA
RADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDV
TLANHMEAGGRAGRIHITRATLQYLNGDYEVEPGRGGERNAYLKEQHIETFLILGASQKR
KEEKAMLAKLQRARANSMEGLMPRWVPDRAFSRTKDSKAFRQMGIDDSSKDNRGAQDALN
PEDEVDEFLSRAIDARSIDQLRKDHVRRFLLTFQREDLEKKYSRKVDPRFGAYVACALLV
FCFICFIQLLVFPHSTLMLGIYASIFLLLLITVLICAVYSCGSLFPKALQRLSRSIVRSR
AHSTAVGIFSVLLVFTSAIANMFTCNHTPIRTCAAQMLNLTPADITACHLQQLNYSLGLD
VPLCEDTEPTCSFPEYFIGNMLLSLLASSVFLHISSIGKLAMIFVLGLIYLVLLLLGPPA
TIFDNYDLLLGVHGLASSNETFDGLDCPAAGRVALKYMTPVILLVFALALYLHAQQVEST
ARLDFLWKLQATGEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVA
VMFASIANFSEFYVELEANNEGVECLRLLNEIIADFDEIISEEQFRQLEKIKTIGSTYMA
ASGLNASTYDQVGRSHITALADYAMRLMEQMKHINEHSFNNFQMKIGLNMGPVVAGVIGA
RKPQYDIWGNTVNVSSRMDSTGVPDRIQVTTDLYQVLAAKGYQLEYRGVVKVKGKGEMTT
YFLNGGPSS
NT seq 3270 nt NT seq  +upstreamnt  +downstreamnt
atggagctggggctgcgagcagtggccctgggcttcgaggacaccgacatgactccggca
gggggcgggacggctgaggtggcccccgacgctgtgcccaggagccggcgatcctgctgg
gggcgtctagtgcaggtgttccagtcgaagcagttccgttcagccaaactggagcgcctg
taccagcggtacttcttccagatgaaccagagcagcctgacgctgctgatggcggtgctg
gtgctgctcaccgcggtgctgctggccttccatgccgcgcccgcccgccctcagcctgcc
tatgtggccctgctggcctgcgccgccgccctatttgtggctctcatggtggtgtgtaac
cggcatagcttccgccaggactccatgtgggtggtgagctacgtggtgctgggcatcctg
gcggcagtgcaggtggggggcgccctcgcagctgacccgcacagcccctctgcaggcctc
tggtgccccgtgttcttcgtctacatcgcctacacgctcctccccatccgcatgagggct
gctgtcctcagcggtctgggcctctccaccctgcatttgatcttggcctggcaactcaac
cgtagtgatgccttcctctggaagcagctcagtgccaatgtgctgctgttcctctgcacc
aacgtcattggcatctgcacacattacccagcagaggtgtctcagcgccaggcctttcag
gagacccgaggttatatccaggcccgactccacctacagcatgagaatcggcagcaggag
cggttgctgctgtcggtattgccccagcatgttgccatggagatgaaagaagacatcaac
acaaaaaaagaagacatgatgttccacaagatctacatacagaagcatgacaacgtcagc
atcctgtttgcagacattgagggcttcaccagcctggcatcccagtgcaccgcgcaggag
ctggtcatgaccctgaatgagctctttgcccggtttgacaagctggctgcggaaaatcac
tgcctgaggatcaagatcttgggggactgttactactgtgtgtcagggttaccagaggcc
cgggcagaccatgcccactgctgtgtggagatgggggtagacatgatcgaggccatctcg
ctggtacgtgaggtgacaggtgtaaatgtgaacatgcgcgtgggcatccacagcggacgt
gtgcactgtggtgtccttggcctgcggaaatggcagttcgatgtgtggtccaatgacgtg
accctggccaaccacatggaggcaggaggccgggccggccgcatccacatcactcgggca
acgctgcaatacctgaacggggactacgaggtggagccaggccgtggtggcgagcgcaac
gcatacctcaaggagcagcacattgagactttcctcatcctgggtgccagccagaaacgg
aaagaggagaaggccatgctggccaagctgcagcgggcccgggccaactccatggaaggg
ctgatgccacgctgggttcccgatcgtgccttctccaggaccaaggactccaaggccttc
cgccagatgggcattgatgattccagcaaagacaaccggggtgcccaagatgccctgaac
cctgaggatgaggtggatgagttcctgagccgtgccatcgatgcccgcagcatagatcag
ctgcggaaggaccacgtgcgccggtttctgctcaccttccagagagaggatcttgagaag
aagtactcccggaaggtggatccccgctttggagcctacgttgcctgtgccctgttggtc
ttctgcttcatctgcttcatccagcttctcgtcttcccacactccaccctgatgcttggg
atctatgccagcatcttcctgctgctgctgatcaccgtgctgatctgtgctgtatactcc
tgtggttctctgttccctaaggccctgcaacgtctgtcccgcagcatcgtccgctcgcgg
gcacacagcactgcagttggcatcttttctgttctgcttgtgtttacctctgccattgcc
aacatgttcacctgtaaccacacccccatacggacctgtgcagcccagatgctgaattta
acacctgctgatatcactgcctgccacctgcagcagctcaattactctctgggcctggat
gtgcccctgtgtgaggacaccgagcccacctgcagcttccctgagtacttcatcgggaac
atgctgctgagtctcctggccagctctgtcttcctgcacatcagcagcatcgggaagttg
gccatgatctttgtcttggggctcatctatttggtgctgcttctgctgggtcccccagcc
accatctttgacaactatgacctactgcttggtgtccatggcttggcttcttccaatgag
acctttgatgggctggactgtccagctgcagggagggtggccctcaaatatatgacccct
gtgattctgctggtgtttgcgctggcgctgtatctgcatgctcagcaggtggagtcgact
gctcgcctggacttcctctggaaactgcaggcaacaggagagaaggaggagatggaggag
ctccaggcatacaaccggaggctgctgcataacattctacccaaggacgtggccgcccac
ttcctggcccgggagcgtcgcaatgatgaactctactatcagtcgtgtgagtgtgtggct
gttatgtttgcctccattgccaacttctctgagttctatgtggagctggaggcaaacaat
gagggtgtcgagtgcctgcggctgctcaacgagatcatcgctgactttgatgagatcatc
agcgaggagcagttccggcagctggaaaagatcaagacaattggtagcacctacatggct
gcctcagggctgaatgccagcacctacgatcaggtgggccgctcccacatcactgccctg
gctgactacgccatgcggctcatggagcagatgaagcacatcaatgagcactctttcaac
aatttccagatgaagattgggctgaacatgggcccagttgtggcaggtgtcattggggcc
cggaagccgcagtatgacatctgggggaacacagtgaatgtttctagccgtatggacagc
acgggggtccccgaccgaatccaggtgaccacggacctgtaccaggttctagctgccaag
ggctaccagctggagtatcgaggggtggtcaaggtgaagggcaagggggagatgaccacc
tacttcctcaatgggggccccagcagttag

DBGET integrated database retrieval system