KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100405612Help
Entry
100405612         CDS       T03264                                 

Gene name
ATIC
Definition
(RefSeq) 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase
  KO
K00602  phosphoribosylaminoimidazolecarboxamide formyltransferase / IMP cyclohydrolase [EC:2.1.2.3 3.5.4.10]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00230  Purine metabolism
cjc00670  One carbon pool by folate
cjc01100  Metabolic pathways
cjc01523  Antifolate resistance
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100405612 (ATIC)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    100405612 (ATIC)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100405612 (ATIC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100405612 (ATIC)
Enzymes [BR:cjc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.3  phosphoribosylaminoimidazolecarboxamide formyltransferase
     100405612 (ATIC)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.10  IMP cyclohydrolase
     100405612 (ATIC)
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100405612 (ATIC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AICARFT_IMPCHas MGS Ribosomal_L12_N
Motif
Other DBs
NCBI-GeneID: 100405612
NCBI-ProteinID: XP_002749795
Ensembl: ENSCJAG00000011695
UniProt: U3CG69
Position
6
AA seq 592 aa AA seqDB search
MAPGQLALFSVSDKTGLVEFARNLISLGLNLVASGGTAKALRDAGLAVRDVSELTGFPEM
LGGRVKTLHPAVHAGILARNIPEDNADMARLDFNLIRVVACNLYPFVKTVASPGVTVEEA
VEQIDIGGVTLLRAAAKNHARVTVVCEPEDYVAVSTEMQSSESKDTSLETRRQLALKAFT
HTAQYDEAISDYFRKQYSKDVSQMPLRYGMNPHQTPAQLYTLKPKLPITVLNGAPGFINL
CDALNAWQLVKELKEALGIPAAASFKHVSPAGAAVGIPLSEDEARVCMVFDLYKTLTPIS
TAYARARGADRMSSFGDFVALSDVCDVPTAKIISREVSDGIIAPGYEEEALTILSKKKNG
NYCVLQMDQSYKPDENEVRTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIV
ATIAVKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGDKANYWWLRHHPQVLSMKFKT
GVKRAEISNAIDQYVTGTIGEDEDLIKWKALFEEVPELLTEAEKKEWVDKLSEVSVSSDA
FFPFRDNVDRAKRSGVAYIAAPSGSAADKVVIEACDELGIILAHTNLRLFHH
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atggctcccggccagctcgccttgttcagtgtctctgacaaaaccggccttgtggaattt
gcaagaaacctgatctctctcggtttgaatctggtcgcttccggagggactgcaaaagct
ctcagggatgctggtctggcagtcagagatgtctctgagttgacaggatttcctgaaatg
ttggggggacgtgtgaaaactttgcatcctgcagtccatgctggaatcctggctcgcaat
attccagaagataatgctgacatggccagacttgatttcaatcttataagagttgttgcc
tgcaatctctatccctttgtgaagacagtggcttctccaggtgtaactgttgaggaagct
gtggagcaaattgacattggtggagtaaccttactgagagctgcagccaaaaaccacgct
cgagtgacagtggtgtgtgaacctgaggactacgtggcagtgtccacagagatgcagagc
tccgagagcaaggacacctccttggagactagacgccagttagccttgaaggcattcact
catacggcacaatacgatgaagcaatttcagattatttcaggaaacagtacagcaaagac
gtatctcagatgcccttgcggtatggaatgaaccctcatcagacccctgcacagctgtac
acactgaagcccaagcttcccatcacagttctaaatggagcccctggatttataaacctg
tgcgatgctttgaatgcctggcagctggtgaaggaactcaaagaggcgttaggtattcca
gccgctgcctctttcaaacatgtcagcccagcaggtgccgctgttggaattccactcagt
gaagatgaggccagagtctgcatggtttttgatctctataaaacccttacacccatttca
acggcatacgcaagagcaagaggggctgataggatgtcgtcatttggcgattttgtggca
ttgtctgacgtttgtgatgtaccaactgcaaaaattatttccagagaagtctctgatggt
ataattgccccaggatatgaagaagaagccttgacaatactttccaaaaagaaaaatgga
aactactgtgttcttcagatggaccagtcttacaaaccagatgaaaatgaagttcgaacg
ctcttcggtcttcatttaagccagaagagaaataacggtgtcgttgacaagtcattattt
agcaatgttgtcaccaagaataaagatctgccagagtctgccctccgagacctcatcgta
gccaccattgctgtcaagtacactcagtccaactccgtgtgctacgccaagaatgggcag
gttatcggcattggagctggacagcagtctcgtatacactgcacccggcttgcaggagat
aaggcaaactactggtggcttagacaccatccacaggtgctctcgatgaagtttaaaacg
ggagtgaagagagcagaaatctccaatgccatcgatcaatacgtgactggaaccatcggc
gaggatgaagatttgataaagtggaaggccctgtttgaggaagtccctgaattactcact
gaggcagagaagaaggaatgggttgacaaacttagtgaagtttctgtcagctcagatgcc
ttcttccctttcagagataatgtagacagagctaaaaggagcggtgtggcctacattgcg
gctccctccggctctgctgctgacaaagttgtgatcgaggcctgcgatgaactgggaatc
atcctcgctcatacgaaccttcggctcttccaccactga

DBGET integrated database retrieval system