KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100405714Help
Entry
100405714         CDS       T03264                                 

Gene name
CHRNA4
Definition
(RefSeq) cholinergic receptor nicotinic alpha 4 subunit
  KO
K04806  nicotinic acetylcholine receptor alpha-4
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04080  Neuroactive ligand-receptor interaction
cjc04725  Cholinergic synapse
cjc05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100405714 (CHRNA4)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    100405714 (CHRNA4)
 09160 Human Diseases
  09165 Substance dependence
   05033 Nicotine addiction
    100405714 (CHRNA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cjc04040]
    100405714 (CHRNA4)
Ion channels [BR:cjc04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   100405714 (CHRNA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_memb Neur_chan_LBD
Motif
Other DBs
NCBI-GeneID: 100405714
NCBI-ProteinID: XP_002747818
Ensembl: ENSCJAG00000010168
UniProt: U3C1L4
Position
5
AA seq 627 aa AA seqDB search
MELGGPGAQRLLSPLLLLLGAGLLRASGHVETRAHAEERLLKKLFSGYNKWSRPVANISD
VVLVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPADYENVTSIRIPSELIWR
PDIVLYNNADGDFAVTHLTKAHLFHDGRVQWTPPAIYKSSCSIDVTFFPFDQQNCTMKFG
SWTYDKAKIDLVSMHSRVDQLDFWESGEWVIVDAVGTYNTRKYECCAEIYPDITYAFVIR
RLPLFYTVNLIIPCLLISCLTVLVFYLPSECGEKVTLCISVLLSLTVFLLLITEIIPSTS
LVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPRTHTMPAWVRRVFLDIVPRLLLMKR
PSVVKDNCRQLIESMHKMASAPRFWPEPEGEPPITSGTHSWHPPSPSFCVPLDTPADPGH
ACKSPSDPLPALQPPEAEKASPHPLPGPCRSSHSTQASGLAKARSLSVQHMSSPGEVAEG
ILRCRSRSIQYCAPRDDAAPEADGQAVGALASHKAHSAELPPPDQASPCKCTCRKEPPST
SSSATLKARSTKVLPRHLPLSPALTRAVEGVQYIADHLKAEDTDFSVKEDWKYVAMVIDR
IFLWMFIIVCLLGTVGLFLPPWLAGMI
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atggagctcgggggcccgggggcgcagcggctgctgtcgccgctgctgctgctcctgggg
gccggcctcctgcgcgccagcggccatgtggagaccagggcccacgcggaggagcggctc
ctgaagaaactcttctctggttacaacaagtggtcacgacccgtggccaacatctcggat
gtggtccttgtccgctttggcctgtccatcgctcagctcatcgatgtggacgagaagaac
cagatgatgaccacgaacgtgtgggtgaagcaggagtggcatgactacaagctgcgctgg
gacccagctgactatgagaacgtcacctccatccgcatcccctctgagctcatctggcgg
ccggacattgtcctatacaacaacgccgatggggactttgccgtgacccacctgaccaag
gcccacctgttccacgatgggcgggtgcagtggacgccgccggcaatctacaagagctcc
tgcagcatcgacgttaccttcttccccttcgaccagcagaactgcaccatgaagttcggc
tcctggacctacgacaaggccaagatcgacctagtgagcatgcacagccgtgtggaccag
ctggacttctgggagagcggtgagtgggtgatcgtggacgccgtgggcacctacaacacc
aggaagtacgagtgctgcgccgagatttaccccgacatcacgtacgccttcgtcatccgg
cggctgccactcttctacacggtcaacctcatcatcccctgcctgctcatctcctgcctc
accgtgctggtcttctacctgccctccgagtgtggcgagaaggtcacgctgtgcatttcc
gtgctgctgtcgctcaccgtcttccttctgctcatcaccgagatcatcccatccacctcg
ctggtcatcccgctcattggcgagtacctgctgttcaccatgatcttcgtcaccctgtcc
attgtcatcactgtcttcgtgctcaacgtgcaccaccgatcgccgcgcacgcacaccatg
cccgcctgggtgcgcagggtcttcctggacatcgtgcctcgcctgctgctcatgaagcgg
ccatccgtggtcaaggacaattgccggcagctcatcgaatccatgcacaagatggccagt
gccccgcgattctggcccgagcccgagggggaaccccccatcacgagcggcacccacagc
tggcacccgccctcgccgtccttctgtgtgcccctggacacgccggctgatcccggccat
gcctgcaagtcaccctccgaccccctccccgctctgcagcccccggaggccgagaaggcc
agcccccaccccttgccgggaccctgccgctcatcccacagtacccaggcctcagggctg
gccaaagccaggtccctcagcgtccagcacatgtccagccctggcgaggtggcggagggt
atcctgcggtgccggtctcggagcatccagtactgcgctccccgagacgatgccgcccct
gaggcggacggccaggctgttggcgccctggcctctcacaaggcccactcggcggagctc
ccacctccagaccaggcctctccgtgcaaatgcacatgcaggaaggagccgccttccaca
tcctcgagcgccacgctcaaggcccgcagcaccaaagtgctgccccggcatctgcccctg
tcaccagccctgacccgggcagtagagggcgtccagtacatcgcggaccacctgaaggcc
gaagacacagacttctcggtgaaggaggactggaagtacgtggccatggtcatcgaccgc
atcttcctttggatgttcatcatcgtctgcctgctggggactgtgggcctcttcctgcca
ccctggctggctggcatgatctag

DBGET integrated database retrieval system