KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100405725
Entry
100405725         CDS       T03264                                 
Symbol
ACLY
Name
(RefSeq) ATP citrate lyase
  KO
K01648  ATP citrate (pro-S)-lyase [EC:2.3.3.8]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00020  Citrate cycle (TCA cycle)
cjc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100405725 (ACLY)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100405725 (ACLY)
Enzymes [BR:cjc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.8  ATP citrate synthase
     100405725 (ACLY)
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100405725 (ACLY)
  Exosomal proteins of bladder cancer cells
   100405725 (ACLY)
  Exosomal proteins of melanoma cells
   100405725 (ACLY)
SSDB
Motif
Pfam: Citrate_bind Citrate_synt Ligase_CoA CoA_binding ATP-grasp_2 Succ_CoA_lig
Other DBs
NCBI-GeneID: 100405725
NCBI-ProteinID: XP_008995830
Ensembl: ENSCJAG00000014988
UniProt: F7DBY4
Position
5:complement(113444214..113497142)
AA seq 1101 aa
MSAKAISEQTGKELLYKFICTTSAIQNRFKYARVTPDTDWARLLQDHPWLLSQNLVVKPD
QLIKRRGKLGLVGVNLTLDGVKSWLKPRLGQEATVGKATGFLKNFLIEPFVPHSQAEEFY
VCIYATREGDYVLFHHEGGVDVGDVDAKAQKLLVGVDEKLNPEDIKKHLLVHAPEDKKEI
LASFISGLFNFYEDLYFTYLEINPLVVTKDGVYVLDLAAKVDATADYICKVKWGDIDFPP
PFGREAYPEEAYIADLDAKSGASLKLTLLNPKGRIWTMVAGGGASVVYSDTICDLGGVNE
LANYGEYSGAPSEQQTYDYAKTILSLMTREKHPDGKILIIGGSIANFTNVAATFKGIVRA
IRDYQGPLKEHEVTIFVRRGGPNYQEGLRVMGEVGKTTGIPIHVFGTETHMTAIVGMALG
HRPIPNQPPTAAHTANFLLNASGSTSTPAPSRTASFSESRADEVAPAKKAKPAMPQDSVP
SPRSLQGKSATLFSRHTKAIVWGMQTRAVQGMLDFDYVCSRDEPSVAAMVYPFTGDHKQK
FYWGHKEILIPVFKNMADAMRKHPEVDVLINFASLRSAYDSTMETMNYTQIRTIAIIAEG
IPEALTRKLIKKADQKGVTIIGPATVGGIKPGCFKIGNTGGMLDNILASKLYRPGSVAYV
SRSGGMSNELNNIISRTTDGVFEGVAIGGDRYPGSTFMDHVLRYQDTPGVKMIVVLGEIG
GTEEYKICRGIKEGRLTKPIVCWCIGTCATMFSSEVQFGHAGACANQASETAVAKNQALK
EAGVFVPQSFDELGEIIQSVYEDLVANGVIVPAQEVPPPTVPMDYSWARELGLIRKPASF
MTSICDERGQELIYAGMPITEVFKEEMGIGGVLGLLWFQKRLPKYSCQFIEMCLMVTADH
GPAVSGAHNTIICARAGKDLVSSLTSGLLTIGDRFGGALDAAAKMFSKAFDSGIIPMEFV
NKMKKEGKLIMGIGHRVKSINNPDMRVQILKDYVRQHFPATPLLDYALEVEKITTSKKPN
LILNVDGLIGVAFVDMLRNCGSFTREEADEYIDIGALNGIFVLGRSMGFIGHYLDQKRLK
QGLYRHPWDDISYVLPEHMSM
NT seq 3306 nt   +upstreamnt  +downstreamnt
atgtcggccaaggcaatttcggagcagacaggcaaagaactgctttacaagttcatctgc
accacctcagccatccagaatcggttcaagtatgctcgggtcactcctgacacagactgg
gcccgcctgctgcaggaccacccctggctgctcagccagaaccttgtagtcaagccagac
cagctgatcaaacgtcgtggaaaacttggcctagttggggtcaacctcactctggatggg
gtcaagtcctggctaaagccacggctgggacaggaagccacagttggcaaggccacaggc
ttcctcaagaactttttaatcgagcccttcgtcccccacagtcaggcggaggaattctac
gtctgcatctatgccacccgagaaggggactacgtcctgttccaccatgagggaggtgtg
gacgtgggtgatgtggatgccaaggcccagaagctgcttgttggtgtggatgagaaactg
aatcctgaggacatcaaaaaacacctgttggtccacgcccctgaagacaagaaagaaatt
ctggccagttttatctccggcctcttcaatttctacgaggacctgtacttcacctacctc
gagatcaatccccttgtggtgaccaaagatggagtctatgtccttgacttggcggccaag
gtggacgccactgccgactacatctgcaaagtgaaatggggcgacattgacttccctccc
ccctttggacgggaagcatatccagaggaagcctacattgcagacctagatgccaaaagt
ggggcgagcctgaagctgaccttgctgaaccccaaggggaggatctggaccatggtggcc
gggggtggtgcctctgtcgtttacagtgataccatctgtgatctagggggtgtcaacgag
ctggcaaactatggggagtactcaggcgcccccagcgagcagcagacctatgactatgcc
aagacgatcctctccctcatgacccgagagaagcacccagatggcaagatactcattatc
ggaggcagcatcgcaaacttcaccaatgtggctgccacgttcaagggcattgtgagagca
attcgagattaccaaggccccctgaaggagcatgaagtcacaatctttgtccgaagaggt
ggccctaactatcaggagggcttacgggtaatgggagaagtcgggaagaccactgggatc
cccatccatgtctttggcacggagactcacatgacggccattgtgggcatggccctgggc
caccggcccatccccaaccagccacccacagcagcccacactgcaaacttcctcctcaat
gccagcgggagcacatcgacgccagcccccagcaggacagcatctttttctgagtccagg
gccgatgaggtggcacctgcaaagaaggccaagcctgccatgccacaagattcagtccca
agtccaagatccttgcaaggaaagagcgctaccctcttcagccgccacaccaaggccatt
gtgtggggcatgcagacccgggccgtgcaaggcatgctggactttgactatgtctgttcc
cgagacgagccctcagtggctgccatggtctaccctttcactggggatcacaagcagaag
ttttactgggggcacaaggagatcctgatccctgtcttcaagaacatggctgatgccatg
aggaagcacccagaggtagatgtgctcatcaactttgcctctctccgctctgcctatgat
agcaccatggagaccatgaactacacacagatccggaccatcgccatcatagccgaaggc
atccctgaggctctcacgagaaagctgatcaagaaggcagaccagaagggagtgacaatc
atcggacctgccactgttggaggcatcaagcctgggtgctttaagattggaaacacaggt
gggatgctggacaacatcctggcctccaaactgtaccgcccaggcagtgtggcctatgtc
tcccgttccggaggcatgtccaatgagctcaataatatcatctctcggaccacagatggc
gtctttgagggcgtggccattggtggggacaggtacccaggctcaacattcatggatcat
gtgttacgctaccaggacactccaggagtcaaaatgattgtggttcttggagagatcggg
ggcactgaggaatataagatttgccggggcatcaaggagggccgcctcaccaagcccatc
gtctgctggtgcattgggacctgtgccaccatgttctcctctgaggtccagtttggccat
gctggagcttgtgccaaccaggcttctgaaactgcagtagccaagaaccaggctttgaag
gaagcaggagtgtttgtgccccagagctttgatgagcttggagagatcatccaatctgtg
tatgaagatcttgtggccaatggagtcattgtacctgcccaagaggtgccgcccccaacc
gtgcccatggactactcctgggccagggagctgggtttgatccgaaaacctgcctcgttc
atgaccagcatctgtgacgagcggggacaggaactcatctatgctggcatgcccatcacc
gaggtcttcaaggaagagatgggcatcggtggggtcctcggcctcctctggttccagaaa
aggttgcccaaatactcttgccagttcattgagatgtgtctgatggtgacagctgatcat
gggccagctgtctctggagcccacaacaccatcatttgtgcacgagctgggaaagacctg
gtctccagcctcacctcggggctgctcactatcggggatcggtttgggggtgccttggat
gcagcagccaagatgttcagtaaagcctttgacagtggcattatccccatggagtttgtg
aacaagatgaagaaggaagggaaactgatcatgggcattggtcaccgtgtaaaatcgata
aacaacccagacatgcgagtgcagatcctcaaagattacgtcaggcagcacttccctgcc
actcctctgctcgattatgccctggaagtggagaagattaccacctcgaagaagccaaat
cttatcctgaatgtagatggtctcattggagttgcgtttgtagacatgcttagaaactgt
gggtcctttactcgggaggaagctgatgaatatattgacattggagccctcaatggcatc
tttgtgctgggaaggagtatgggcttcattggacactatcttgatcagaagaggctgaag
caggggctgtatcgtcatccgtgggatgatatttcatatgttcttccggaacacatgagc
atgtaa

DBGET integrated database retrieval system