KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100405930Help
Entry
100405930         CDS       T03264                                 

Gene name
LY96
Definition
(RefSeq) lymphocyte antigen 96
  KO
K05400  lymphocyte antigen 96
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04064  NF-kappa B signaling pathway
cjc04620  Toll-like receptor signaling pathway
cjc05133  Pertussis
cjc05145  Toxoplasmosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100405930 (LY96)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100405930 (LY96)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05133 Pertussis
    100405930 (LY96)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100405930 (LY96)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 100405930
NCBI-ProteinID: XP_002759156
Ensembl: ENSCJAG00000000577
UniProt: F6R457
Position
16
AA seq 160 aa AA seqDB search
MLPFIIFSTLFSSMFTEAQKQHWICNSSDASISYTYCDKMQYPISINIDPCIKLTGTKGL
LHIFYIPRRDLKQLYFNLYITVNSMNLPKRKEVICPGSDDDYSFCRALKGETLNITIPFS
FKGIKFSKGRYKCVAEAISGSPEEMLFCLEFVIIHHPNSN
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgctgccatttataattttttccaccctattttcttccatgtttactgaagctcagaag
cagcactggatctgcaactcctccgatgcaagtatttcatacacctactgtgataaaatg
caatacccaatttcaattaatattgatccctgtataaaactgacgggaaccaaaggattg
ttgcacattttctacattccacggagagatttaaagcaattatacttcaatctctatata
actgtcaactccatgaatcttccaaagcgaaaagaagttatttgcccaggatctgatgat
gattattctttctgcagagctctgaagggagagactttgaatatcacaataccattctcc
ttcaagggaataaaattttctaagggacgatacaaatgtgttgctgaagctatttctggg
agtcctgaagaaatgctcttttgcttggagtttgtcatcatacaccatcctaattcaaat
tag

DBGET integrated database retrieval system