KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100406138
Entry
100406138         CDS       T03264                                 
Symbol
PCDH17
Name
(RefSeq) protocadherin 17
  KO
K16499  protocadherin delta 2
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:cjc04515]
    100406138 (PCDH17)
Cell adhesion molecules [BR:cjc04515]
 Cadherins
  Protocadherins
   100406138 (PCDH17)
SSDB
Motif
Pfam: Cadherin Cadherin_2 Cadherin_C_2 Cadherin_4 NUC153
Other DBs
NCBI-GeneID: 100406138
NCBI-ProteinID: XP_002742673
Ensembl: ENSCJAG00000003715
UniProt: F7F2V1
Position
1:complement(57339278..57440612)
AA seq 1159 aa
MYLSICCCFLLWAPALTLKNLNYSVPEEQGAGTVIGNIGKDARLQPGLPPAERGGGGRSK
SGSYRVLENSAPHLLDVDADSGLLYTKQRIDRESLCRHNAKCQLSLEVFANDKEICMIKV
EIQDINDNAPSFPSDQIEMDISENAAPGTRFPLTSAHDPDAGENGLRTYLLTRDDHGLFA
LDVKSRGDGTKFPELVIQKALDREQQNHHTLVLTALDGGEPPRSATVQINVKVIDSNDNS
PVFEAPSYLVELPENAPLGTVVIDLNATDADEGPNGEVLYSFSSYVPDRVRELFSIDPKT
GLIRVKGNLDYEENGMLEIDVQARDLGPNPIPAHCKVTVKLIDRNDNAPSIGFVSVRQGA
LSEAAPPGTVIALVRVTDRDSGKNGQLQCRVLGGGGTGGGGGLGGPGGSVPFKLEENYDN
FYTVVTDRPLDRETQDEYNVTIVARDGGSPPLNSTKSFAVKILDENDNPPRFTKGLYVLQ
VHENNIPGEYLGSVLAQDPDLGQNGTVSYSILPSHIGDVSIYTYVSVNPTNGAIYALRSF
NFEQTKSFEFKVLAKDSGAPAHLESNATVRVTVLDVNDNAPVIVLPTLQNDTAELQVPRN
AGLGYLVSTVRALDSDFGESGRLTYEIVDGNDDHLFEIDPSSGEIRTLHPFWEDVTPVVE
LVVKVTDHGKPTLSAVAKLIIRSVSGSLPEGVPRVNGEQHHWDMSLPLIVTLSTISIILL
AAMITIAVKCKRENKEIRTYNCRIAEYSHPQLGGGKGKKKKINKNDIMLVQSEVEERNAM
NVMNVVSSPSLATSPMYFDYQTRLPLSSPRSEVMYLKPASNNLTVPQGHAGCHTSFTGQG
TNASDTPATRMSIIQTDNFPAEPNYMGSRQQFVQSSSTFKDPERASLRDSGHGDSDQADS
DQDTNKGSCCDMSVREALKMKTTSTKSQPLEQEPEECVNCTDECRVLGHSDRCWMPQFPA
ANQAENADYRTNLFVPTVEANVETETYETVNPTGKKTFCTFGKDKREHTILIANVKPYLK
AKRALSPLLQEVPSASSSPTKACMEPCTSTKGSLDGCEAKPGALAEAGSQYLPTDSQYLS
PSKQPRDPSFMASDQMARVFADVHSRTSRDSSEMGAVLEQLDHPNRDLGRESVDAEEVVR
EIDKLLQDCRGNDPVAVRK
NT seq 3480 nt   +upstreamnt  +downstreamnt
atgtacctttccatctgttgctgtttccttctatgggcccctgccctcacgcttaagaac
ctcaactactccgtgccagaggaacaaggggccggcacggttatcgggaacatcggcaag
gatgcccgactgcagcctgggcttccgccggcagagcgcggcggcggagggcgcagcaag
tctggtagctaccgggtgctggagaactcggctccgcacctgctggacgtggacgcggac
agcgggctcctctacaccaagcagcgcatcgaccgggagtccctgtgtcgccacaacgcc
aagtgccagctgtctctcgaggtgttcgccaacgacaaggagatctgcatgatcaaggta
gagatccaggacatcaacgacaacgcgccttccttcccctcggatcagatcgaaatggac
atctcggagaacgcagccccgggtacccgcttcccactcaccagcgcacatgaccccgac
gccggcgagaacgggctccgcacctacctgcttacgcgcgacgaccacggcctctttgca
ctggacgtcaagtcccgcggcgacggcaccaagttcccagagctggtcatccagaaggcc
ctggaccgcgagcagcagaatcaccatacgctcgtgctgactgctctggacggtggcgag
cctccacgttccgccaccgtacagatcaacgtgaaggtgattgactccaacgacaacagc
ccggtcttcgaggcaccgtcctacttggtggaattgcccgagaacgctccgctgggcacc
gtggtcatcgatctgaacgccaccgacgccgacgagggtcccaatggcgaagtgctctac
tccttcagcagctacgtgcccgaccgcgtgcgggagctcttctccatcgaccccaagacc
ggcctcatccgtgtgaagggcaacctggactatgaggagaacgggatgctggagatcgac
gtgcaggcccgagatctggggcctaaccccatcccagcccactgcaaggtcacggtcaag
ctcatcgaccgcaacgacaacgcgccgtccatcggtttcgtctccgtgcgccagggggcg
ctgagcgaggccgcccctcccggcaccgtcatcgccctggtgcgggtcactgaccgagac
tcgggcaagaacgggcagctgcagtgtcgggtcctgggcggaggagggaccggcggcggc
gggggcctgggcggacccgggggttccgtccccttcaagcttgaagagaactatgacaac
ttctacacggtggtgactgaccgcccgctggaccgcgagacgcaagacgagtacaacgtg
accatcgtggcgcgggacgggggctcgcctcccctcaactccaccaagtcgttcgcggtc
aagattctagacgagaacgacaacccgcctcggttcaccaaagggctctacgtgcttcag
gtgcacgagaacaacatcccgggagaatacctgggctctgtgctcgcccaggatcccgac
ctgggccagaatggcaccgtgtcctactctatcttgccctcgcacatcggcgacgtgtct
atctacacctatgtgtctgtcaatcccacgaacggggccatctatgccctgcgctccttt
aacttcgagcagaccaagtctttcgagttcaaggtgcttgctaaggactcgggggcgccc
gcgcacttggagagcaacgccacggtgagggtgacagtgctagacgtgaatgacaacgct
ccggtgatcgtgcttcccacgctgcagaacgacaccgcggagctgcaggtgccgcgcaac
gccggcctgggctatctggtgagcactgtgcgcgccctagacagcgacttcggcgagagc
gggcgcctcacctacgagatcgtggacggcaacgacgaccacctgtttgagatcgacccg
tccagcggcgagatccgcacgctgcaccccttctgggaggacgtgacgcccgtggtggag
ctggtggtgaaggtgaccgaccacggcaagcccaccctgtccgcagtggccaagctcatc
atccgttctgtgagcggctcccttcccgagggggtaccacgggtgaatggcgagcagcac
cactgggacatgtcgctgccgctcatcgtgactctgagcactatttccatcatcctccta
gcggccatgatcaccatcgccgtcaagtgcaagcgcgagaacaaggagatccgcacttat
aactgccgcatcgccgagtacagccacccgcagctgggcgggggcaagggcaagaaaaag
aagatcaacaaaaatgatatcatgctggtgcagagcgaagtggaggaaaggaacgccatg
aacgtcatgaacgtggtgagcagcccctccctggctacctcccctatgtacttcgattac
cagacccgcctgcccctcagctcgccccggtcggaggtgatgtatctcaaaccggcctcc
aacaacctgactgtccctcaggggcacgcgggctgccacaccagcttcaccggacaaggg
actaatgcaagcgacacccctgccactcggatgtccataattcagacagacaattttccc
gcagagcccaattacatgggcagcaggcagcagtttgttcaaagtagctccacgtttaag
gacccagaaagagccagcctgagagacagtgggcacggggacagtgatcaggctgacagt
gaccaagacactaacaaaggctcctgctgtgacatgtctgttagggaggcactcaagatg
aaaacgacttcaactaaaagccaaccacttgaacaagaaccggaagagtgtgttaattgc
acagatgaatgccgagtgcttggtcattctgacaggtgttggatgccacagttccctgca
gccaatcaggctgaaaatgcagattaccgcacaaatctctttgtacctacagttgaagct
aatgttgagactgagacttatgaaactgtgaatcccactgggaaaaagactttttgtaca
tttggaaaagacaagcgagagcacactattctcattgccaacgttaaaccttatttaaaa
gccaaacgtgccctgagccctcttctccaagaggtcccctcagcatcaagcagcccaacc
aaggcatgcatggagccttgcacctcaacaaaaggctccctggatggttgtgaagcaaaa
ccaggagccctagctgaagcaggcagtcagtacttgcccactgacagtcagtatctgtcg
cccagtaagcaaccaagagacccttctttcatggcttccgatcagatggcaagggtcttt
gcagatgtgcattccagaaccagccgggattccagtgagatgggtgctgttcttgagcag
cttgaccaccccaacagggatctgggcagagagtccgtggatgcagaggaagttgtgaga
gaaattgataagcttttgcaagactgccggggaaatgacccagtggctgtgagaaagtga

DBGET integrated database retrieval system