KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100406322Help
Entry
100406322         CDS       T03264                                 

Gene name
MAP3K5
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 5
  KO
K04426  mitogen-activated protein kinase kinase kinase 5 [EC:2.7.11.25]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01524  Platinum drug resistance
cjc04010  MAPK signaling pathway
cjc04071  Sphingolipid signaling pathway
cjc04141  Protein processing in endoplasmic reticulum
cjc04210  Apoptosis
cjc04530  Tight junction
cjc04668  TNF signaling pathway
cjc04714  Thermogenesis
cjc04722  Neurotrophin signaling pathway
cjc04932  Non-alcoholic fatty liver disease (NAFLD)
cjc05014  Amyotrophic lateral sclerosis (ALS)
cjc05418  Fluid shear stress and atherosclerosis
Module
cjc_M00688  MAPK (JNK) signaling
cjc_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100406322 (MAP3K5)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100406322 (MAP3K5)
   04668 TNF signaling pathway
    100406322 (MAP3K5)
   04071 Sphingolipid signaling pathway
    100406322 (MAP3K5)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100406322 (MAP3K5)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100406322 (MAP3K5)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100406322 (MAP3K5)
  09159 Environmental adaptation
   04714 Thermogenesis
    100406322 (MAP3K5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    100406322 (MAP3K5)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100406322 (MAP3K5)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100406322 (MAP3K5)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100406322 (MAP3K5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100406322 (MAP3K5)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     100406322 (MAP3K5)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: STE group
  STE11 family
   100406322 (MAP3K5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4071 Pkinase Pkinase_Tyr FPP Pkinase_fungal Kinase-like
Motif
Other DBs
NCBI-GeneID: 100406322
NCBI-ProteinID: XP_002747104
Ensembl: ENSCJAG00000008383
UniProt: U3DSH8
Position
4
AA seq 1373 aa AA seqDB search
MSTEAGEGITFSVPPFAPSGFCTIPEGGICRRGGAAAVGESEEHQLPPPPGSFWNVESAA
APGIGCPAASSASSATRCRGSSGGGGSRRTTVAYVINEASQGQLVVAESEALQSLREACE
AVGATLETLHFGKLDFGETTVLDRFYNADIAVVEMSDAFRQPSLFYHLGVRESFSMANNI
ILYCDTNSDSLQSLKEIICQKNTMCTGNYTFVPYMITPHNKVYCCDSSFMKGLTELMQPN
FELLLGPICLPLVDRFIQLLKVAQASSSQYFRESILNDIRKARNLYTGKELAAELARIRQ
RVDNIEVLTADIVINLLLSYRDIQDYDSIVKLVETLEKLPTFDLASHHHVKFHYAFALNR
RNLPGDRAKALDIMIPMVQSEGQVASDMYCLVGRIYKDMFLDSNFTDTESRDHGASWFKK
AFESEPTLQSGINYAVLLLAAGHQFESSFELRKVGVKLSSLLGKKGNLEKLQSYWEVGFF
LGASVLANDHMRVIQASEKLFKLKTPAWYLKSIVETILIYKHFVKLTTEQPVAKQELVDF
WMDFLVEATKTDVTVVRFPVLILEPTKIYQPSYLSINNEVEEKTISIWHVLPDDKKGIHE
WNFSASSVRGVSISKFEERCCFLYVLHNSDDFQIYFCTELHCKKFFEMVNTITEEKGRST
EEGDCESDSLEYDYEYDENGDRVVLGKGTYGIVYAGRDLSNQVRIAIKEIPERDSRYSQP
LHEEIALHKHLKHKNIVQYLGSFSENGFIKIFMEQVPGGSLSALLRSKWGPLKDNEQTIG
FYTKQILEGLKYLHDNQIVHRDIKGDNVLINTYSGVLKISDFGTSKRLAGINPCTETFTG
TLQYMAPEIIDKGPRGYGKAADIWSLGCTIIEMATGKPPFYELGEPQAAMFKVGMFKVHP
EIPESMSAEAKAFILKCFEPDPDKRACANDLLVDEFLKVSSKKKKTQPKLSALSAGSNEY
LRSISLPVPVLVEDTSSSSEYGSVSPDTELKVDPFSFKTRAKSCGERDVKGIRTLFLGIP
DENFEDHSAPPSPEEKDSGFFMLRKDSERRATLHRILTEDQDKIVRNLMESLAQGAEEPK
LKWEHITTLIASLREFVRSTDRKIIATTLSKLKLELDFDSHGISQVQVVLFGFQDAVNKV
LRNHNIKPHWMFALDSIIRKAVQTAITILVPELRPHFSLASESDTADQEDLDVEEDHEEQ
PSNQRVRRPQAVIEDAVATSGVSTLSSTVSHDSQSAHRSLNVQLGRMKIETNRLLEELVR
KEKELQALLHRAIEEKDQEIKHLKLKSQPREIPELPVFHLNSPGTNTEDSELTDWLRENG
ADEDTISRVLAEDYTLVDVLYYVTRDDLKCLRLRGGMLCTLWKAIIDFRNKQT
NT seq 4122 nt NT seq  +upstreamnt  +downstreamnt
atgagcacggaggcgggcgagggcatcactttctccgtgccacccttcgccccctcgggg
ttctgcaccatccccgagggcggcatctgcaggaggggaggagcggcggcggtaggcgag
agcgaggagcaccagctgccaccgccgccgggcagcttctggaacgtggagagcgccgct
gcccctggcatagggtgtcccgcggcctcctccgcgagcagtgccacccggtgccggggc
agctctggtggtggaggcagccgacggaccacggtggcatatgtgatcaacgaagcgagc
caggggcaactggtggtggccgagagcgaggccctgcagagcctgcgggaggcgtgcgag
gcagttggcgccaccttggagaccctgcattttgggaaactcgactttggagaaaccacg
gttctggaccgcttttacaatgcagatatcgcggtggtggagatgagtgatgccttccgg
cagccgtccttgttttaccacctcggggtgagagaaagtttcagcatggccaacaacatc
atcctctactgtgatactaactccgactctctgcagtcactgaaggaaatcatttgccag
aagaatactatgtgcactgggaactacacctttgttccttacatgatcactccacataac
aaggtctactgctgtgacagcagcttcatgaaggggttgacggagctcatgcaaccaaac
ttcgagctgcttcttggacccatctgcttacctctcgtggatcgtttcattcaacttttg
aaggtggcacaagcaagttctagccagtatttccgggaatctatactcaatgatatcagg
aaagctcgtaatttatacactggtaaggaattggcagctgagttggcaagaattcggcag
cgagtagataatatcgaagtcttgacagcagatattgtgataaatctgttactttcctac
agagatatccaggactatgattctattgtgaagctggtagagactttagaaaaactgcca
acctttgatttggcctcccatcaccatgtgaagtttcattatgcatttgcactgaatagg
cgaaatctccctggagacagagcgaaagctcttgatattatgattcccatggtgcaaagt
gaaggacaagttgcttcagatatgtattgcctagttggtcgaatctacaaagatatgttt
ttggactccaatttcacagatactgaaagcagagaccatggggcttcttggttcaaaaag
gcatttgaatcagagccaacactacagtcaggaattaattatgcagtcctcctcctggca
gctgggcaccagtttgaatcttcctttgagctccggaaagttggggtgaagctaagtagc
cttcttggtaaaaagggaaacctggaaaaactccagagctactgggaagttggatttttt
ctgggggccagtgtcctagccaacgaccacatgagagtcattcaagcatctgaaaagctt
tttaaactgaagacaccagcatggtaccttaagtctattgtagagacaattttgatatat
aagcattttgtgaaactgactactgaacagcctgtggccaagcaagaacttgtggacttt
tggatggatttcctggtcgaggccacaaagacagatgttactgtggttaggtttccagta
ttaatattagaaccaaccaaaatctatcaaccttcttatttgtctatcaacaatgaagtt
gaggaaaaaacaatatctatttggcacgtgcttcctgatgacaagaagggtatacatgag
tggaatttcagtgcctcttcagtcaggggagtgagtatttctaagtttgaagaaagatgc
tgttttctgtatgtgctccacaattctgatgatttccaaatctatttctgtacagaactt
cattgtaaaaagttttttgagatggtgaacaccattaccgaagagaaggggagaagcaca
gaggaaggagactgtgaaagtgactccttggagtatgactatgaatatgatgaaaatggt
gacagagtcgttttaggaaaaggcacttacgggatagtctatgcaggtcgggacttgagc
aaccaagtcagaattgctattaaggaaatcccagagagagacagcagatactctcagccc
ctgcatgaagaaatagcattgcataagcacctgaagcacaaaaatattgtccagtatctg
ggctctttcagtgagaatggtttcattaaaatcttcatggagcaggtcccgggaggaagt
ctttctgctctcctccgttccaaatggggtccattaaaagacaatgagcaaacaattggc
ttttatacaaagcaaatactggaaggattaaagtatctccatgacaatcagatagttcac
cgagacataaagggtgacaatgtgctgattaatacctacagtggtgtactcaagatctct
gacttcgggacatcaaagaggcttgctggcataaacccctgtactgaaacttttactggt
accctccagtatatggcaccagaaataatagacaaaggaccaagaggctacggaaaggca
gcagacatctggtctctgggctgcacaatcattgaaatggccacaggaaaacccccattt
tatgaactgggagaacctcaagcagctatgttcaaggtggggatgtttaaagtccaccct
gagatcccagagtccatgtctgcagaggccaaggcattcatactgaaatgttttgaacca
gaccctgacaagagagcctgtgctaacgacttgcttgttgatgagtttttaaaagtttca
agcaaaaagaaaaaaacacaacctaagctttcagctctttcagcgggatcaaacgaatat
ctcaggagtatatccttgccggtacctgtgctggtggaggacaccagcagcagcagtgag
tacggctcagtttcacctgacacggagttgaaagtggaccccttctctttcaaaacaaga
gccaaatcctgtggagaaagagatgtaaagggaattcggacactctttttgggcattcca
gacgagaattttgaagatcacagtgctcccccttcccctgaagaaaaagattccggattc
ttcatgctgaggaaggacagtgagaggcgagccacccttcacaggatcctgacagaagac
caagacaaaattgtgagaaacctgatggaatctttagctcagggggctgaagaaccaaaa
ctaaaatgggaacacatcacaaccctcattgcaagcctcagagaatttgtgagatccact
gatcgaaagatcatagccaccacactgtcaaagctgaaactggagctggactttgacagc
cacggcattagccaagtccaggtggtgctctttggttttcaagatgctgtcaataaagtt
cttcggaatcataacatcaagccacactggatgtttgccttagacagtatcatccggaag
gcagtgcagacagctattaccatcctggttccagaactaaggccgcattttagccttgca
tctgagagtgatactgctgatcaagaagacttggatgtagaagaggaccatgaggaacag
ccttcaaatcaaagggttcgaagacctcaggctgtcattgaagatgctgtggctacctca
ggcgtgagcacgctcagttctactgtgtcccatgattcccagagtgctcaccggtcactg
aatgtacagcttgggaggatgaaaatagaaaccaatagattactggaagaattggttcgg
aaagagaaagaattacaagcactccttcatcgagctattgaagaaaaagaccaagaaatt
aaacacctaaagcttaagtcccaacccagagaaattcctgagttgcctgtatttcaccta
aattctcctggcacaaatactgaagattctgaacttacggactggctgagggaaaatgga
gctgatgaagacactataagccgggttttagctgaagattatacactagtagatgttctc
tactatgttacacgtgatgacttaaaatgcttgagactaaggggcgggatgctgtgcacc
ctgtggaaggccatcattgactttcgaaacaaacagacttga

DBGET integrated database retrieval system