KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100406335Help
Entry
100406335         CDS       T03264                                 

Gene name
EDA, TNLG7C
Definition
(RefSeq) ectodysplasin A
  KO
K05480  ectodysplasin-A
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04064  NF-kappa B signaling pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100406335 (EDA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100406335 (EDA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100406335 (EDA)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Tumor necrosis fators
   100406335 (EDA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF Collagen
Motif
Other DBs
NCBI-GeneID: 100406335
NCBI-ProteinID: XP_008987680
UniProt: F7I3J3
Position
X
AA seq 389 aa AA seqDB search
MGSPEMERREPLPATAPRERESQSCGCRGAPARAGEGNSCRLFLGFFGLSLALHLLTLCC
YLELRSELRRERGALSRLGGPGTSGTLNSPGGLDPDSPITRHLGQPSPQQQPPLEPGEAA
LPSDSQDGHQMALLNFFFPDEKPYSEEESRHVHRNKRSKSNEGADGPVKNKKKGKKAGPP
GPNGPPGPPGPPGPQGPPGIPGIPGIPGTTVMGPPGPPGPPGPQGPPGLQGPSGTADKAG
TRENQPAVVHLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELEVLVDGTYF
IYSQVEVYYINFTDFASYEVVVDEKPFLQCTRSIETGKTNYNTCYTAGVCLLKARQKIAV
KMVHADISINMSKHTTFFGAIRLGEAPAS
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgggctccccggagatggagcgcagggaacccctgcccgcgacagcgccgcgggagcgg
gagagccagagctgcggctgtcgcggggcccctgctcgggcgggcgaagggaacagctgc
cggctcttcctgggtttctttggcctctcgctggccctccacctgctgacgttgtgctgc
tacctagagttgcgctcggagttgcggcgggaacggggagccctatcccgccttggcggc
ccgggcacctctggcaccctaaacagccccggtggcctcgaccctgacagccccatcacc
cgtcaccttgggcagccgtcacctcagcagcagccgcctttggaaccgggagaagccgca
ctcccctctgactcccaggacgggcaccagatggccctattgaatttcttcttccctgat
gaaaagccatactctgaagaagaaagtaggcatgttcaccgcaataaaagaagcaaaagc
aatgaaggagcagatggtccagttaaaaacaagaaaaaaggaaagaaggcagggcctcct
ggacccaatggccctccaggacccccaggacctccaggaccccagggacccccaggaatt
ccagggattcctggaattccaggaacaactgttatgggaccacctggtcctccaggtcct
cctggtcctcaaggaccccctggcctccagggaccttctggtactgctgataaagctgga
actcgagaaaaccagccagctgtggtgcatctacagggccaggggtcagcaattcaagtc
aagaatgatctttcaggtggagtgcttaatgactggtctcgcatcactatgaacccgaag
gtgtttaagctacatccccgcagcggggagctggaggtactggtggacggcacctacttc
atctatagtcaggtagaagtatactacatcaacttcactgactttgccagctatgaggtg
gtggtggatgagaagcccttcctgcagtgcacacgcagcatcgagacgggcaagaccaac
tacaacacttgctataccgcaggcgtctgcctccttaaggcccggcagaagatcgccgtg
aagatggtgcatgctgacatctccatcaacatgagcaagcacaccaccttctttggggcc
atcaggctgggtgaagcccctgcatcttag

DBGET integrated database retrieval system