KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100406401Help
Entry
100406401         CDS       T03264                                 

Gene name
IL1A
Definition
(RefSeq) interleukin 1 alpha
  KO
K04383  interleukin 1 alpha
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04010  MAPK signaling pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04217  Necroptosis
cjc04218  Cellular senescence
cjc04380  Osteoclast differentiation
cjc04640  Hematopoietic cell lineage
cjc04932  Non-alcoholic fatty liver disease (NAFLD)
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc04940  Type I diabetes mellitus
cjc05020  Prion diseases
cjc05132  Salmonella infection
cjc05133  Pertussis
cjc05140  Leishmaniasis
cjc05152  Tuberculosis
cjc05162  Measles
cjc05164  Influenza A
cjc05321  Inflammatory bowel disease (IBD)
cjc05323  Rheumatoid arthritis
cjc05332  Graft-versus-host disease
cjc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100406401 (IL1A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100406401 (IL1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100406401 (IL1A)
   04218 Cellular senescence
    100406401 (IL1A)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100406401 (IL1A)
  09158 Development
   04380 Osteoclast differentiation
    100406401 (IL1A)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    100406401 (IL1A)
   05321 Inflammatory bowel disease (IBD)
    100406401 (IL1A)
   05332 Graft-versus-host disease
    100406401 (IL1A)
  09164 Neurodegenerative disease
   05020 Prion diseases
    100406401 (IL1A)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100406401 (IL1A)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100406401 (IL1A)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100406401 (IL1A)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100406401 (IL1A)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100406401 (IL1A)
   05133 Pertussis
    100406401 (IL1A)
   05152 Tuberculosis
    100406401 (IL1A)
  09172 Infectious disease: viral
   05162 Measles
    100406401 (IL1A)
   05164 Influenza A
    100406401 (IL1A)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100406401 (IL1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100406401 (IL1A)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Interleukins
   100406401 (IL1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL1_propep IL1 NAD_binding_6
Motif
Other DBs
NCBI-GeneID: 100406401
NCBI-ProteinID: XP_002757550
Ensembl: ENSCJAG00000016368
UniProt: U3CV93
Position
14
AA seq 272 aa AA seqDB search
MAKVPDLFEDLKNCYSENEEYSSSIDHLSLNQKSFYDVNYGSHHEECMDQSVSLSISETS
KTSKLTFKESVVIVSTNGKVLKKRRLTLNHSITDDDLEGIANDIEEEIIKPRSAPFSFLS
NAKYNFNKTRKHQFILNVALNHQSVIQTNDQHLMTTALQNLDEAVKFDMDAYISSKDDDK
DYVTLRISKTRLYVSAQDENQPALLKEMPEIPKTITADETNLLFFWETQGTKSYFRSVAH
PDLLIATMQDSLVCLARGPPFITDFQILENQA
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagttccagacctgtttgaagatctgaagaactgttacagtgaaaatgaagag
tacagttcctccattgaccatctctctctgaatcagaaatccttctatgatgtaaactat
ggctcacaccatgaagaatgcatggatcagtctgtgtctctgagtatctctgaaacctct
aagacatccaagcttaccttcaaggagagtgtggtgatagtgtcaaccaatgggaaggtt
ctgaagaagagacggttgactttaaaccattccatcactgatgatgacctggagggcatc
gccaatgacatagaagaagaaatcatcaagcccaggtcagcacctttcagcttcctgagc
aatgcaaaatacaactttaataagaccaggaaacaccagttcatcctgaatgtcgccctc
aatcatcaaagtgtaattcaaaccaacgatcagcacctcatgactactgcattacaaaat
ctggatgaagcagtgaaatttgacatggatgcttatatatcatcaaaggatgatgacaaa
gattatgtgactctaagaatctcaaaaactcgattgtatgtgagtgcccaagatgaaaac
caaccagcgttgctgaaggagatgcctgaaatacccaaaactatcacagctgatgagacc
aacctcctcttcttctgggaaactcaaggaactaagagctacttcagatcagttgcccat
ccagatttgcttattgccacaatgcaagacagtttggtgtgcttggcaagggggccaccc
tttatcactgactttcagatactggaaaaccaggcttag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100406769Help
Entry
100406769         CDS       T03264                                 

Gene name
IL1B
Definition
(RefSeq) interleukin 1 beta
  KO
K04519  interleukin 1 beta
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01523  Antifolate resistance
cjc04010  MAPK signaling pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04064  NF-kappa B signaling pathway
cjc04217  Necroptosis
cjc04380  Osteoclast differentiation
cjc04620  Toll-like receptor signaling pathway
cjc04621  NOD-like receptor signaling pathway
cjc04623  Cytosolic DNA-sensing pathway
cjc04625  C-type lectin receptor signaling pathway
cjc04640  Hematopoietic cell lineage
cjc04657  IL-17 signaling pathway
cjc04659  Th17 cell differentiation
cjc04668  TNF signaling pathway
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04932  Non-alcoholic fatty liver disease (NAFLD)
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc04940  Type I diabetes mellitus
cjc05010  Alzheimer disease
cjc05020  Prion diseases
cjc05132  Salmonella infection
cjc05133  Pertussis
cjc05134  Legionellosis
cjc05140  Leishmaniasis
cjc05142  Chagas disease (American trypanosomiasis)
cjc05143  African trypanosomiasis
cjc05144  Malaria
cjc05146  Amoebiasis
cjc05152  Tuberculosis
cjc05162  Measles
cjc05163  Human cytomegalovirus infection
cjc05164  Influenza A
cjc05168  Herpes simplex virus 1 infection
cjc05321  Inflammatory bowel disease (IBD)
cjc05323  Rheumatoid arthritis
cjc05332  Graft-versus-host disease
cjc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100406769 (IL1B)
   04064 NF-kappa B signaling pathway
    100406769 (IL1B)
   04668 TNF signaling pathway
    100406769 (IL1B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100406769 (IL1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100406769 (IL1B)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100406769 (IL1B)
   04620 Toll-like receptor signaling pathway
    100406769 (IL1B)
   04621 NOD-like receptor signaling pathway
    100406769 (IL1B)
   04623 Cytosolic DNA-sensing pathway
    100406769 (IL1B)
   04625 C-type lectin receptor signaling pathway
    100406769 (IL1B)
   04659 Th17 cell differentiation
    100406769 (IL1B)
   04657 IL-17 signaling pathway
    100406769 (IL1B)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100406769 (IL1B)
  09158 Development
   04380 Osteoclast differentiation
    100406769 (IL1B)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    100406769 (IL1B)
   05321 Inflammatory bowel disease (IBD)
    100406769 (IL1B)
   05332 Graft-versus-host disease
    100406769 (IL1B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100406769 (IL1B)
   05020 Prion diseases
    100406769 (IL1B)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100406769 (IL1B)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100406769 (IL1B)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100406769 (IL1B)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100406769 (IL1B)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100406769 (IL1B)
   05133 Pertussis
    100406769 (IL1B)
   05134 Legionellosis
    100406769 (IL1B)
   05152 Tuberculosis
    100406769 (IL1B)
  09172 Infectious disease: viral
   05162 Measles
    100406769 (IL1B)
   05164 Influenza A
    100406769 (IL1B)
   05168 Herpes simplex virus 1 infection
    100406769 (IL1B)
   05163 Human cytomegalovirus infection
    100406769 (IL1B)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100406769 (IL1B)
   05144 Malaria
    100406769 (IL1B)
   05140 Leishmaniasis
    100406769 (IL1B)
   05142 Chagas disease (American trypanosomiasis)
    100406769 (IL1B)
   05143 African trypanosomiasis
    100406769 (IL1B)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100406769 (IL1B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100406769 (IL1B)
   00536 Glycosaminoglycan binding proteins [BR:cjc00536]
    100406769 (IL1B)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Interleukins
   100406769 (IL1B)
Glycosaminoglycan binding proteins [BR:cjc00536]
 Heparan sulfate/Haparin
  Cytokines
   100406769 (IL1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL1 IL1_propep
Motif
Other DBs
NCBI-GeneID: 100406769
NCBI-ProteinID: XP_002757551
Ensembl: ENSCJAG00000016340
Position
14
AA seq 285 aa AA seqDB search
MNTAYLAPDTLKVSEAAMAEVPELTSEMMTYYSGNEDDLFFEVDGPKQMKCSFQDLDLCP
VDGGIQLRLSRQHYSKGFRQVVSVVVAMEKLRRMPVYCPQTFQDNDLSTFFPFIFEEEPI
IFDTWDNEAYVCDAPVRSLNCTLRDAQQKCLVMSGPYELKALHLQGQDLEQQVVFSMSFV
QGEESNDKIPVALGLKEKNLYLSCVLKDKKPTLQLESVDPKNYPKKKMEKRFVFNKTEIN
NKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVS
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgaatactgcttatctagcacctgacaccctgaaggtgtctgaagcagccatggcagaa
gtacctgaactcaccagtgaaatgatgacttactacagtggcaacgaggatgacttgttc
tttgaagtcgatggtcctaaacagatgaagtgctctttccaggacctggacctctgccct
gtggatggcggcatccagctgcgactctcccgccagcactacagcaagggcttcaggcag
gttgtgtcggttgtcgtggctatggagaagctgaggaggatgccagtttactgcccacag
accttccaggacaatgacctcagcaccttctttcccttcatctttgaagaagaacctatc
atcttcgacacatgggataatgaggcttatgtgtgcgatgcacctgtacgatccctgaac
tgcacactccgggatgcacaacaaaaatgcttggtgatgtccggcccatatgaactgaaa
gctctccacctccagggacaggatctggagcaacaagtggtgttctccatgtcctttgtg
caaggagaagaaagtaatgacaaaatacctgtggccttgggcctcaaagaaaagaatctg
tacctgtcctgtgtgctgaaagataagaagcccactctacagctggagagtgtagaccca
aaaaattacccaaagaagaagatggaaaagcgatttgtcttcaacaagacagaaatcaat
aacaagctggaatttgagtctgcccagttccctaactggtacatcagcacctctcaagca
gaaaacatgcctgtcttcctgggagggaccaaaggcggccaggatataactgacttcacc
atgcaatttgtgtcctaa

DBGET integrated database retrieval system