KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100406419Help
Entry
100406419         CDS       T03264                                 

Gene name
AGTR1
Definition
(RefSeq) angiotensin II receptor type 1
  KO
K04166  angiotensin II receptor type 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04020  Calcium signaling pathway
cjc04022  cGMP-PKG signaling pathway
cjc04072  Phospholipase D signaling pathway
cjc04080  Neuroactive ligand-receptor interaction
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04270  Vascular smooth muscle contraction
cjc04371  Apelin signaling pathway
cjc04614  Renin-angiotensin system
cjc04924  Renin secretion
cjc04925  Aldosterone synthesis and secretion
cjc04927  Cortisol synthesis and secretion
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc04934  Cushing syndrome
cjc05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100406419 (AGTR1)
   04020 Calcium signaling pathway
    100406419 (AGTR1)
   04072 Phospholipase D signaling pathway
    100406419 (AGTR1)
   04022 cGMP-PKG signaling pathway
    100406419 (AGTR1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100406419 (AGTR1)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    100406419 (AGTR1)
   04614 Renin-angiotensin system
    100406419 (AGTR1)
   04925 Aldosterone synthesis and secretion
    100406419 (AGTR1)
   04927 Cortisol synthesis and secretion
    100406419 (AGTR1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100406419 (AGTR1)
   04270 Vascular smooth muscle contraction
    100406419 (AGTR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100406419 (AGTR1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100406419 (AGTR1)
   04934 Cushing syndrome
    100406419 (AGTR1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100406419 (AGTR1)
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cjc04030]
    100406419 (AGTR1)
Membrane trafficking [BR:cjc04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100406419 (AGTR1)
G protein-coupled receptors [BR:cjc04030]
 Rhodopsin family
  Peptide
   Angiotensin
    100406419 (AGTR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 100406419
NCBI-ProteinID: XP_008981943
Ensembl: ENSCJAG00000001517
Position
17
AA seq 359 aa AA seqDB search
MILNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLK
TVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNYLCKMASASVSFNLYASVFLLT
CLSIDRYLAIVHPMKSRLRRTMLLAKVTCIIIWLLAGLASLPAVIHRNVFFIENTNITVC
AFHYESQNSTLPIGLGLTKNILGFLLPFLIILTSYTLIWKALKKAYEIQKNKPRNDDIFK
IIMAIVLFFFFSWIPHQIFTFLDVLIQLGIIHDCRIADIVDTAMPITICIAYFNNCLNPL
FYGFLGKKFKKYFLQLLKYIPPKAKSHSNLSTKMSTLSYRPSDNVSSSTKKPAPCFEVE
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgattctcaattcttctactgaagatggtattaaaagaatccaagatgattgtcccaaa
gctggaaggcataattacatatttgtcatgattcctactttatacagtatcatctttgtg
gtaggaatatttggaaacagcttggtggtgatagtcatttacttttacatgaaactgaag
actgtggccagtgtttttcttttgaatttagcactggctgacttatgctttttactgact
ttgccactgtgggctgtctacaccgctatggaataccgctggccctttggcaattatcta
tgtaagatggcttcagccagcgtcagtttcaacctgtatgctagcgtgtttctactcacg
tgtctcagcattgatcgatacctggctattgttcacccaatgaagtcccgccttcgacgc
acaatgcttctagccaaagtcacctgcatcatcatttggctgctggcgggcttagccagt
ttgccagctgtaatccatcgaaatgtatttttcatcgagaacaccaatattacagtttgt
gctttccattatgagtcccaaaattcaaccctcccaatagggctgggcctgacgaaaaat
attctgggtttcctgcttccttttctgatcattcttacaagttatactcttatttggaag
gccctaaagaaggcttatgaaattcagaagaacaagccaagaaatgatgatatttttaag
ataattatggcaatagtgcttttctttttcttttcctggattccccaccaaatattcact
tttctggatgtattgattcaactaggcatcatacatgactgtagaattgcagatattgtg
gacactgccatgcccatcaccatttgtatagcttattttaacaattgcctgaatcctctt
ttttatggctttctggggaaaaaatttaaaaaatattttctccagcttctaaaatacatt
cccccaaaagccaaatcccactcaaatctttcaacaaaaatgagcacgctttcctaccgc
ccctcagataatgtaagctcatccaccaagaagcctgcaccatgttttgaggttgagtga

DBGET integrated database retrieval system