KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100406530Help
Entry
100406530         CDS       T03264                                 

Gene name
EGR1
Definition
(RefSeq) early growth response 1
  KO
K09203  early growth response protein 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04371  Apelin signaling pathway
cjc04912  GnRH signaling pathway
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc05020  Prion diseases
cjc05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100406530 (EGR1)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    100406530 (EGR1)
   04928 Parathyroid hormone synthesis, secretion and action
    100406530 (EGR1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion diseases
    100406530 (EGR1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100406530 (EGR1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100406530 (EGR1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cjc03000]
    100406530 (EGR1)
Transcription factors [BR:cjc03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Egr/Krox
    100406530 (EGR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF3432 DUF3446 zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2HC_2 Cornifin zf-BED Zf_RING
Motif
Other DBs
NCBI-GeneID: 100406530
NCBI-ProteinID: XP_002744250
Ensembl: ENSCJAG00000006771
UniProt: U3DKB1
Position
2
AA seq 542 aa AA seqDB search
MATAKAEMQLMSPLQISDPFGSFPHSPTMDNYPKLEEMMLLSNGAPQFLGSAGAPEGSGG
NSSSSSSSGGGGGGSNTSSSSGSTFNPQGDTGEQPYEHLTTESFPDISLNNEKVLVETSY
PSQTTRLPPITYTGRFSLEPAPNSGNTLWPEPLFSLVSGLVSMTNPPASSSSAPSPAASS
SSSASQSPPLSCTVPSNDSSPIYSAAPTFPTPNTDIFPEPQSQAFPGSAGTALQYPPPAY
PAKGGFQVPMIPDYLFPQQQADLGLGTPDQKPFQALESRTQQPSLTPLSTIKAFATQSGS
QDLKALNTSYQSQLIKPSRMRKYPNRPSKTPPHERPYACPVESCDRRFSRSDELTRHIRI
HTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQ
KDKKADKSVVASSATSSLSSYPSPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSST
YPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTIE
IC
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atggccacggccaaggccgagatgcagctgatgtctccgctgcagatctctgacccgttc
ggatcctttcctcactcgcccaccatggacaactaccccaagctggaggagatgatgctg
ctgagcaacggggctccccagttccttggctccgctggggccccagagggcagcggcggt
aacagcagcagcagcagcagcagcgggggcggcgggggcggcagcaacactagcagcagc
agcggcagcaccttcaaccctcagggggatacgggcgagcaaccctacgagcacctgacc
acagagtcttttcctgacatctctctgaacaacgagaaggtgctggtggagacaagttac
cccagtcaaaccactcgactgccccccatcacctatacgggccgcttttctctggagcct
gcacccaacagtggcaacaccttgtggcccgagcccctcttcagcctggtcagtggcctc
gtgagcatgaccaacccgccagcctcttcgtcctcagcaccatctccagcggcctcttcc
tcctcctccgcctcccagagcccacccctgagctgcacagtgccatccaacgacagcagt
cccatttactcagcggcacctaccttccccacgccaaacactgacattttccctgagcca
caaagccaggccttcccgggctcggcagggacggcgctccagtatccgcctcccgcctac
cccgccaagggtggcttccaggttcccatgatccccgactacctgtttccacagcagcag
gcagacctgggcctgggcaccccagaccagaagcccttccaggccctggagagccgcacc
cagcagccttcgctcactcccctgtctactatcaaggcctttgccactcagtcgggctcc
caggacctgaaggccctcaataccagctaccagtcccagctcatcaaacccagccgcatg
cgcaagtaccccaaccggcccagcaagacacccccacacgaacgcccttatgcctgccca
gtggagtcctgtgatcgccgcttttcccgctccgacgagctcacccgccacatccgcatc
cacacaggccagaagcccttccagtgccgcatctgcatgcgcaacttcagccgcagcgac
caccttaccacccacatccgcacccacacgggcgagaagcccttcgcctgcgacatctgt
gggagaaagtttgccaggagcgatgaacgcaagaggcataccaagatccacttgcggcag
aaggacaagaaagcagacaaaagtgttgtggcctcttcggccacctcctccctctcttcc
tacccatccccagttgctacctcttacccgtccccagttactacctcttatccgtcccca
gccaccacctcatacccgtcccctgtgcccacctccttctcctctcctggctcctcgacc
tacccatcccctgtgcacagtggcttcccctcgccgtcggtggccactacgtactcctcg
gttccccctgctttccctgcccaggtcagcagcttcccttcctcagctgttaccaactcc
ttcagcgcctccacagggctttcggacatgacagcaaccttttctcccaggacaattgaa
atttgctaa

DBGET integrated database retrieval system