KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100406536Help
Entry
100406536         CDS       T03264                                 

Gene name
IL4
Definition
(RefSeq) interleukin 4
  KO
K05430  interleukin 4
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04151  PI3K-Akt signaling pathway
cjc04630  Jak-STAT signaling pathway
cjc04640  Hematopoietic cell lineage
cjc04657  IL-17 signaling pathway
cjc04658  Th1 and Th2 cell differentiation
cjc04659  Th17 cell differentiation
cjc04660  T cell receptor signaling pathway
cjc04664  Fc epsilon RI signaling pathway
cjc04672  Intestinal immune network for IgA production
cjc05140  Leishmaniasis
cjc05200  Pathways in cancer
cjc05310  Asthma
cjc05320  Autoimmune thyroid disease
cjc05321  Inflammatory bowel disease (IBD)
cjc05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    100406536 (IL4)
   04151 PI3K-Akt signaling pathway
    100406536 (IL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100406536 (IL4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100406536 (IL4)
   04660 T cell receptor signaling pathway
    100406536 (IL4)
   04658 Th1 and Th2 cell differentiation
    100406536 (IL4)
   04659 Th17 cell differentiation
    100406536 (IL4)
   04657 IL-17 signaling pathway
    100406536 (IL4)
   04664 Fc epsilon RI signaling pathway
    100406536 (IL4)
   04672 Intestinal immune network for IgA production
    100406536 (IL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100406536 (IL4)
  09163 Immune disease
   05310 Asthma
    100406536 (IL4)
   05320 Autoimmune thyroid disease
    100406536 (IL4)
   05321 Inflammatory bowel disease (IBD)
    100406536 (IL4)
   05330 Allograft rejection
    100406536 (IL4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100406536 (IL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100406536 (IL4)
   00536 Glycosaminoglycan binding proteins [BR:cjc00536]
    100406536 (IL4)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Interleukins
   100406536 (IL4)
Glycosaminoglycan binding proteins [BR:cjc00536]
 Heparan sulfate/Haparin
  Cytokines
   100406536 (IL4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL4 DNA_III_psi Mannosyl_trans3
Motif
Other DBs
NCBI-GeneID: 100406536
NCBI-ProteinID: NP_001244157
Ensembl: ENSCJAG00000013083
UniProt: A4ZXA4
Position
2
AA seq 151 aa AA seqDB search
MGLTSQLLPALFFLLAWAGNFVHGHNCDIALEEIIKTLNIVTEQKTLCTKLTIMDIFAAS
KNTTEKETFCRAATVLRQFYSHHEKDTHCLGATAQQLHSHKQLIRSLKRLDRNLCSLAGL
NSCPVKEADQTMLKDFLERLKMIMKEIYSKC
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgggtctcacctcccaactgcttcccgctctgttcttcctgttagcatgggccggcaac
tttgtccatggacacaactgcgatatcgccttagaggagatcatcaaaactttgaacatt
gtcacagagcaaaagactctgtgcaccaagttgaccataatggacatctttgctgcctcc
aagaacacaactgagaaggaaaccttctgcagggctgcgactgtgctccggcagttctac
agccaccatgagaaggacactcactgcctgggtgcaactgcacagcagttacacagtcac
aagcagctgatccgatccctaaaacggctggacaggaacctctgcagcctggcgggcttg
aactcctgtcctgtgaaggaagccgaccagactatgttgaaagacttcttggaaaggcta
aagatgatcatgaaagagatatattcaaagtgttga

DBGET integrated database retrieval system