KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100406608Help
Entry
100406608         CDS       T03264                                 

Gene name
MTOR
Definition
(RefSeq) mechanistic target of rapamycin
  KO
K07203  serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01521  EGFR tyrosine kinase inhibitor resistance
cjc01522  Endocrine resistance
cjc04012  ErbB signaling pathway
cjc04066  HIF-1 signaling pathway
cjc04072  Phospholipase D signaling pathway
cjc04136  Autophagy - other
cjc04140  Autophagy - animal
cjc04150  mTOR signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc04152  AMPK signaling pathway
cjc04211  Longevity regulating pathway
cjc04213  Longevity regulating pathway - multiple species
cjc04218  Cellular senescence
cjc04371  Apelin signaling pathway
cjc04630  Jak-STAT signaling pathway
cjc04659  Th17 cell differentiation
cjc04714  Thermogenesis
cjc04910  Insulin signaling pathway
cjc04919  Thyroid hormone signaling pathway
cjc04920  Adipocytokine signaling pathway
cjc04930  Type II diabetes mellitus
cjc04931  Insulin resistance
cjc05163  Human cytomegalovirus infection
cjc05165  Human papillomavirus infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05206  MicroRNAs in cancer
cjc05210  Colorectal cancer
cjc05212  Pancreatic cancer
cjc05214  Glioma
cjc05215  Prostate cancer
cjc05221  Acute myeloid leukemia
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
cjc05230  Central carbon metabolism in cancer
cjc05231  Choline metabolism in cancer
cjc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100406608 (MTOR)
   04371 Apelin signaling pathway
    100406608 (MTOR)
   04630 Jak-STAT signaling pathway
    100406608 (MTOR)
   04066 HIF-1 signaling pathway
    100406608 (MTOR)
   04072 Phospholipase D signaling pathway
    100406608 (MTOR)
   04151 PI3K-Akt signaling pathway
    100406608 (MTOR)
   04152 AMPK signaling pathway
    100406608 (MTOR)
   04150 mTOR signaling pathway
    100406608 (MTOR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100406608 (MTOR)
   04136 Autophagy - other
    100406608 (MTOR)
  09143 Cell growth and death
   04218 Cellular senescence
    100406608 (MTOR)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100406608 (MTOR)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100406608 (MTOR)
   04920 Adipocytokine signaling pathway
    100406608 (MTOR)
   04919 Thyroid hormone signaling pathway
    100406608 (MTOR)
  09149 Aging
   04211 Longevity regulating pathway
    100406608 (MTOR)
   04213 Longevity regulating pathway - multiple species
    100406608 (MTOR)
  09159 Environmental adaptation
   04714 Thermogenesis
    100406608 (MTOR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100406608 (MTOR)
   05206 MicroRNAs in cancer
    100406608 (MTOR)
   05205 Proteoglycans in cancer
    100406608 (MTOR)
   05230 Central carbon metabolism in cancer
    100406608 (MTOR)
   05231 Choline metabolism in cancer
    100406608 (MTOR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100406608 (MTOR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100406608 (MTOR)
   05212 Pancreatic cancer
    100406608 (MTOR)
   05225 Hepatocellular carcinoma
    100406608 (MTOR)
   05226 Gastric cancer
    100406608 (MTOR)
   05214 Glioma
    100406608 (MTOR)
   05221 Acute myeloid leukemia
    100406608 (MTOR)
   05215 Prostate cancer
    100406608 (MTOR)
   05224 Breast cancer
    100406608 (MTOR)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100406608 (MTOR)
   04931 Insulin resistance
    100406608 (MTOR)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100406608 (MTOR)
   05168 Herpes simplex virus 1 infection
    100406608 (MTOR)
   05163 Human cytomegalovirus infection
    100406608 (MTOR)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100406608 (MTOR)
   05165 Human papillomavirus infection
    100406608 (MTOR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100406608 (MTOR)
   01522 Endocrine resistance
    100406608 (MTOR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100406608 (MTOR)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100406608 (MTOR)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100406608 (MTOR)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   100406608 (MTOR)
Membrane trafficking [BR:cjc04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    100406608 (MTOR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAT PI3_PI4_kinase DUF3385 FRB_dom FATC HEAT_2 IFRD UME V-ATPase_H_N HEAT_EZ EPSP_synthase TMEM154
Motif
Other DBs
NCBI-GeneID: 100406608
NCBI-ProteinID: XP_008998649
Ensembl: ENSCJAG00000002191
Position
7
AA seq 2552 aa AA seqDB search
MLGTGPAAATTTATISSNVSVLQQFASGLKSRNEETRAKAAKELQHYVTMELREMSQEES
TRFYDQLNHHIFELVSSSDANERKGGILAIASLIGVEGGNATRIGRFANYLRNLLPSNDP
VVMEMASKAIGRLAMAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVP
TFFFQQVQPFFDNIFVAVWDPKQAIREGAVAALRACLILTTQREPKEMQKPQWYRHTFEE
AEKGFDETLAKEKGMNRDDRIHGALLILNELVRISSMEGEVRSRCREEMEEITQQQLVHD
KYCKDLMGFGTKPRHITPFTSFQAVQPQQSNALVGLLGYSSHQGLMGFGTSPSPAKSTLV
ESRCCRDLMEEKFDQVCQWVLKCRNSKNSLIQMTILNLLPRLAAFRPSAFTDTQYLQDTM
NHVLSCVKKEKERTAAFQALGLLSVAVRSEFKVYLPRVLDIIRAALPPKDFAHKRQKAMQ
VDATVFTCISMLARAMGPGIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQD
GLLKMLSLVLMHKPLRHPGMPKGLAHQLASPGLTTLPEASDVGSITLALRTLGSFEFEGH
SLTQFVRHCADHFLNSEHKEIRMEAARTCSRLLTPSIHLISGHAHVVSQTAVQVVADVLS
KLLVVGITDPDPDIRYCVLASLDERFDAHLAQAENLQALFVAXXXXXXEIRELAICTVGR
LSSMNPAFVMPFLRKMLIQILTELEHSGIGRIKEQSARMLGHLVSNAPRLIRPYMEPILK
ALILKLKDPDPDPNPGVINNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKR
QVALWTLGQLVASTGYVVEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPY
KHKVNIGMIDQSRDASAVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMR
IFRDQSLSHHHTMVVQAITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLG
MLVSFVKSHIRPYMDEIVTLMREFWVMNTSIQSTIILLIEQIVVALGGEFKLYLPQLIPH
MLRVFMHDNSPGRIVSIKLLAAIQLFGANLDDYLHLLLPPIVKLFDAPEAPLPSRKAALE
TVDRLTESLDFTDYASRIIHPIVRTLDQSPELRSTAMDTLSSLVFQLGKKYQIFIPMVNK
VLVRHRINHQRYDVLICRIVKGYTLADEEEDPLIYQHRMLRSGQGDALASGPVETGPMKK
LHVSTINLQKAWGAARRVSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDL
FNAAFVSCWSELNEDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDD
NGIVLLGERAAKCRAYAKALHYKELEFQKGPTPAILESLISINNKLQQPEAAAGVLEYAM
KHFGELEIQATWYEKLHEWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQC
CEKWTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLF
SLAQQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQ
IWWERLQGCQRIVEDWQKILMVRSLVVSPHEDMRTWLKYASLCGKSGRLALAHKTLVLLL
GVDPSRQLDHPLPTVHPQVTYAYMKNMWKSARKIDAFQHMQHFVQTMQQQAQHAIATEDQ
QHKQELHKLMARCFLKLGEWQLNLQGINESTIPKVLQYYSAATEHDRSWYKAWHAWAVMN
FEAVLHYKHQNQARDEKKKLRHTSGANITNATTAATTAATATTTASTEGSNSESEAESTE
NSPTPSPLQKKVTEDLSKTLLMYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHWP
DVNEALVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYPLT
VASKSTTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASRL
YFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDL
TQAWDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIA
PSLQVITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLR
KNLSIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDH
LTLMQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLG
DRHPSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYR
ITCHTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEI
LDGVELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTGRDFSHDD
TLDVPTQVELLIKQATSHENLCQCYIGWCPFW
NT seq 7659 nt NT seq  +upstreamnt  +downstreamnt
atgcttggaactggacctgccgccgccaccaccactgccaccatatctagcaatgtgagc
gttctgcagcagtttgccagcggcttgaagagccggaatgaggagaccagggccaaagct
gccaaggagctccagcactatgtcaccatggagctccgagagatgagtcaagaggagtct
actcgcttctatgaccagctgaaccatcacatttttgaattggtttccagctcagatgcc
aatgagaggaaaggtggcatcttggccatagccagcctcataggagtggaaggtgggaat
gccacccgaattggcagatttgccaactatcttcggaacctcctcccctccaatgaccca
gttgtcatggaaatggcatccaaggccattggccgccttgccatggcaggggacactttc
actgccgaatatgtggaatttgaggtgaagcgagccctggaatggctgggtgctgaccgc
aatgagggccggagacacgcagctgtcctggttctccgtgagctggccatcagcgtccct
accttcttcttccagcaagtgcagcccttctttgacaacatttttgtggccgtgtgggac
cccaaacaggccatccgtgagggagctgtagccgcccttcgtgcctgtctgattcttacc
acccagcgtgagccaaaggagatgcagaagcctcagtggtaccggcacacatttgaagaa
gcagagaaggggtttgatgagaccttggccaaagagaagggcatgaatcgggatgatcgg
atccatggagccttgctgatccttaacgagctggtccgaatcagcagcatggagggagag
gtgagaagccgctgcagagaagaaatggaagaaatcacccagcagcagctggtacacgac
aagtactgcaaagatctcatgggctttggaacaaagcctcgtcacattacccccttcacc
agtttccaggctgtgcagccccaacagtcaaatgccttggtggggctgctggggtacagc
tctcaccaaggcctcatgggatttgggacctcccccagcccagctaagtccaccctggtg
gagagccggtgttgcagagacttgatggaggagaaatttgatcaggtgtgccagtgggtg
ctgaaatgcaggaatagcaagaactcgctgatccagatgacaatccttaatttgttgccc
cgcttggctgcattccgaccttctgccttcacagatacccagtatctccaagataccatg
aaccacgtcctaagctgtgtcaagaaagaaaaggaacgtacagcagccttccaagccctg
gggctactttctgtggctgtgaggtctgagtttaaggtctatttgcctcgtgtgctggac
atcatccgagcagccctgccccctaaggacttcgcccataagaggcagaaggcaatgcaa
gtggatgccacagtctttacttgcatcagcatgctggctcgagcaatggggccaggcatc
cagcaggatatcaaggaactgctggagcccatgctggcagtgggactaagccctgccctc
actgctgtactctatgacctgagccgtcagattccacagctaaagaaggacattcaagac
gggctactgaaaatgctgtccctggtccttatgcacaaacccctccgccacccaggcatg
cccaagggcctggcccatcagctggcctcccctgggctcacgactctccctgaggccagt
gatgtgggcagcatcactcttgccctccgaacacttggcagctttgaatttgaaggtcac
tctctgacccaattcgttcgccactgtgcagatcatttcctgaacagtgagcacaaggag
atccgcatggaggctgcccgtacctgctcccgcctgctcacaccctccatccacctcatc
agtggccatgctcatgtggttagccagactgcagtgcaagtggtggcagatgtgctcagc
aaactgctcgtggttgggataacagatcctgaccctgacattcgctattgtgtcttggcg
tccctggatgagcgctttgatgcacacctggcccaggcggagaacttgcaggccttgttt
gtggcnnnnnnnnnnnnnnnnnttgagatccgggagctggccatctgcactgtgggccga
ctcagtagcatgaaccccgcctttgtcatgcctttcctgcgcaagatgctcatccagatt
ttgacagagctggagcacagtgggattggaagaatcaaagagcagagtgcccgtatgctg
gggcacctggtctctaatgcccctagactcatccgcccctacatggagcctattctgaag
gcattaattttgaaactgaaagatccagaccctgatccaaacccaggtgtgatcaacaat
gtcctggccacaataggagaattggcacaggttagtggcctggaaatgagaaaatgggtt
gatgaactttttattatcatcatggacatgctccaggattcttctttgttggccaaaaga
caggtggctctgtggaccctgggacagttggtggccagcactggctatgtggtagagccc
tacaggaagtaccctactttgcttgaggtgctactgaattttctgaagactgagcagaac
cagggtacacgcagagaggccatccgtgtgttagggcttttaggggctttggatccctat
aagcacaaagtgaacattggcatgatagaccagtcccgggatgcctctgctgtcagcctg
tcagaatccaagtcaagtcaggattcctctgactatagcactagtgaaatgctggtcaac
atgggaaacctgcctctggatgagttctacccagctgtgtccatggtggccctgatgcgg
atcttccgagaccagtcactctctcaccaccacaccatggtcgtccaggctatcacgttc
atcttcaagtccctgggactcaaatgtgtgcagttcctgccccaagtcatgcccacgttc
cttaatgtcattcgggtctgtgatggggccatccgggaatttttgttccagcagctggga
atgttggtgtcctttgtgaagagccacatcagaccttatatggatgaaatagtcaccctc
atgagagaattctgggtcatgaacacctcaattcagagcacgatcattcttctcattgag
caaattgtggtagctcttgggggtgaatttaagctgtacctgccccagctgatcccgcac
atgctgcgtgttttcatgcatgacaacagcccaggccgcatcgtctcaatcaagttattg
gctgcaatccagctgtttggtgccaacctggatgactacctgcatttgctgctgcctcct
attgtgaagttgtttgatgcccctgaagctcccctgccgtctcgaaaggcagcgctggag
accgtggaccgtctgacggagtccctggatttcactgactatgcctcccggatcattcac
cctattgttcgaacactggaccagagcccagaactgcgctccacagccatggacacactg
tcttcacttgtttttcaactggggaagaagtaccaaattttcattccaatggtgaataaa
gttctggtgcgacaccgaatcaatcatcagcgctatgacgtgctcatctgcagaattgtc
aagggatacacacttgctgatgaagaggaggatcctttgatttaccagcatcgaatgctt
aggagtggccaaggggatgcactggctagtggaccagtggaaacaggacccatgaagaaa
ctgcacgtcagcaccatcaacctccaaaaggcatggggcgctgccaggagggtctccaaa
gatgactggctggaatggctgaggcggctgagcctggaactgctgaaggactcatcatcg
ccctccctgcgatcctgctgggccctggcacaggcctacaacccgatggccagggatctc
ttcaatgctgcatttgtgtcctgctggtctgagctgaatgaagatcaacaggatgagctc
atcagaagcatcgagttggccctcacctcacaagacattgctgaagtcacacaaaccctc
ttaaacttggctgagttcatggaacacagtgacaagggacccctgccactgagagacgac
aatggcattgttctgctgggtgagagagctgccaagtgccgagcatatgccaaagcacta
cactacaaagaactggagttccagaaaggccccacccctgccattctagaatctctcatc
agcattaataataagctacagcagccagaggcagcagctggagtgttggaatatgccatg
aaacactttggagagctggagatccaggctacctggtatgagaaactgcacgagtgggag
gatgctcttgtggcctatgataagaaaatggacaccaacaaggatgacccagagctgatg
ctgggccgcatgcgctgccttgaggccctgggggaatggggtcaactccaccagcagtgc
tgtgaaaagtggaccctggttaatgatgagacccaagccaagatggcccggatggctgct
gcagctgcgtggggtttaggtcagtgggacagcatggaagaatacacctgtatgatccct
cgtgacacccatgatggggcattctatagagctgtgctggcactgcatcaggacctcttc
tccttggcacagcagtgcattgacaaggccagggacctgctggatgctgaattaactgcg
atggcaggagagagttacagtcgggcatatggggccatggtttcttgccacatgctgtcc
gagctggaggaggttatccagtacaaacttgtccccgagcgacgagagatcatccgccag
atctggtgggagagactgcagggctgccagcgtattgtagaggactggcagaaaatcctt
atggtgcggtcccttgtggtcagccctcatgaggacatgagaacctggctcaagtatgca
agcttgtgcggcaagagtggcaggctggctcttgctcataaaaccttagtattgctcctg
ggagttgatccgtctcggcaacttgaccatcctctgccaacagttcaccctcaggtgacc
tatgcctacatgaaaaacatgtggaagagtgctcgaaagatcgatgccttccaacacatg
cagcattttgtccagaccatgcagcaacaggcccagcatgccatcgctactgaggaccag
cagcataagcaggaactgcacaagctcatggcccgatgcttcctgaaacttggagagtgg
cagctgaatctacagggcatcaatgagagcacaatccccaaagtgctgcagtactacagc
gctgccacagaacacgaccgcagctggtacaaggcctggcacgcatgggcagtgatgaac
ttcgaagccgtgctacactacaaacatcagaaccaagcccgcgacgagaaaaagaaactg
cgtcataccagcggggccaacatcaccaacgccaccactgctgccaccacggctgccact
gccactaccactgccagcactgagggcagcaacagtgagagcgaggctgagagcactgag
aacagccccaccccttcgccgctgcagaagaaggtcactgaggatctgtccaaaaccctc
ctgatgtacacagtgcctgccgtccagggcttcttccgttctatctccttgtcacgaggc
aacaacctccaggatacactcagagttctcaccttatggtttgattatggtcactggcca
gatgtcaatgaagccttagtggagggggtgaaagccatccagattgatacctggctacag
gttatacctcagctcattgcaagaattgatacacccagacccttggtgggacgtctcatt
caccagcttctcacagacattggtcgataccacccccaggccctcatttaccctctgaca
gtggcttctaagtctaccacgacagcccggcacaacgcagccaacaagattctgaagaat
atgtgtgagcacagcaacactctggtccagcaggccatgatggtgagtgaggagctgatc
cgagtggccatcctctggcatgagatgtggcacgaaggcctggaagaggcttctcgtttg
tactttggagagaggaatgtgaaaggcatgtttgaggtgctggagcccttgcatgctatg
atggaacggggcccccagactctgaaggaaacatcctttaaccaggcctatggtcgagat
ttaatggaggcccaagaatggtgcaggaagtacatgaaatcagggaatgtcaaggacctc
actcaagcctgggacctctattatcatgtgttccgacgaatctcaaagcagctgcctcag
ctcacatccttagagctgcagtatgtttccccaaaactcctgatgtgccgagacctcgaa
ttggctgtgccaggaacatatgaccccaaccagccaatcattcgcattcagtccatagca
ccgtctttgcaagtcatcacatccaagcagaggccccggaaattgacacttatgggcagc
aacgggcatgagtttgttttccttctaaaaggccatgaagatctgcgacaggatgagcgt
gtgatgcagctcttcggcctggttaacacccttctggccaatgacccaacatctcttcgg
aaaaacctcagcatccagagatatgccgtcatccctttatcaaccaactctggcctcatt
ggctgggtcccccactgtgacacgctgcacgccctcatccgagactacagggagaagaag
aagatccttctcaacattgaacatcgcatcatgttgcggatggccccagactatgaccac
ttgactctgatgcagaaggtggaggtgtttgagcatgccgtcaataatacagctggagac
gacctggccaagctgctgtggctgaaaagccccagctctgaggtgtggtttgaccgaaga
accaattatacccgttctttagcggtcatgtcaatggttgggtatattttaggcctggga
gatagacacccatccaacctgatgctggaccgtctgagtgggaagatcctgcacattgac
tttggggactgctttgaggttgctatgacccgagagaagtttccagagaagattccattt
agactaacaagaatgttgaccaatgctatggaggttacaggcctggatggcaactacaga
atcacatgccacacggtgatggaggtgctgcgggagcacaaggacagtgtcatggccgtg
ctggaagcctttgtctatgaccccttgctgaactggaggctgatggacacaaataccaaa
ggcaacaagcgatcccgaacgaggacagattcctactctgctggccagtcagtagaaatt
ttggatggtgtggaacttggggaaccagcccataagaaaacggggaccacagtgccagaa
tctattcattctttcattggagacggtttggtgaaaccagaggccctaaataagaaagct
attcagattattaacagagttcgagataagctcactggtcgggacttctctcatgatgac
actttggatgttccaacacaagttgagctgctcatcaaacaagcgacatcccatgaaaac
ctctgccagtgctacattggctggtgccctttctggtaa

DBGET integrated database retrieval system