KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100406787Help
Entry
100406787         CDS       T03264                                 

Gene name
MLH1
Definition
(RefSeq) mutL homolog 1
  KO
K08734  DNA mismatch repair protein MLH1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01524  Platinum drug resistance
cjc03430  Mismatch repair
cjc03460  Fanconi anemia pathway
cjc05200  Pathways in cancer
cjc05210  Colorectal cancer
cjc05213  Endometrial cancer
cjc05226  Gastric cancer
Module
cjc_M00295  BRCA1-associated genome surveillance complex (BASC)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    100406787 (MLH1)
   03460 Fanconi anemia pathway
    100406787 (MLH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100406787 (MLH1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100406787 (MLH1)
   05226 Gastric cancer
    100406787 (MLH1)
   05213 Endometrial cancer
    100406787 (MLH1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100406787 (MLH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cjc03400]
    100406787 (MLH1)
DNA repair and recombination proteins [BR:cjc03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    MutL homologs
     100406787 (MLH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mlh1_C DNA_mis_repair HATPase_c_3 HATPase_c CAF1
Motif
Other DBs
NCBI-GeneID: 100406787
NCBI-ProteinID: XP_002759776
Ensembl: ENSCJAG00000012414
Position
17
AA seq 758 aa AA seqDB search
MSFVAGVIRRLDETVVNRIAAGEVIQRPANAIKEMIENCLDAKSTSIQVVVKEGGLKLIQ
IQDNGTGIRKEDLDIVCERFTTSKLQSFEDLASISTYGFRGEALASISHVAHVTITTKTA
DGKCAYRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKALKNPSEEYGKILEVV
GRYSIHNSGISFSVKKQGETVADVRTLPSASTVDNIRSIFGNAVSRELIEIGCEDKTLAF
RMNGYISNANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLEISP
QNVDVNVHPTKHEVHFLHEESILERVQQHIESKLLGSNSSRMYFTQTLLPGLAGPSGEMV
KSTTSLTSSSTSGSGDKLYAHQMVRTDSREQKLDAFLQPLSKPLSSQPQAIVPEDKTDIS
SGGARQQDEEMLELPAPAEMAAKNQSLEGDTTKATSEMSEKRGPTSRPGNPRKRHREDSD
VDMVEDDSRKDMTAACTPRRRIINLTSVLSLQEEINERGHEILREMLHDHSFVGCVNPQW
ALAQHQTKLYLLNTTKLSEELFYQILIYDFANFGVLRLSEPAPLFDLAMLALDSPESGWT
EEDGPKEGLAEYIVEFLKKKAEMLADYFSLEIDEEGSLIGLPLLIDNYVPPLEGLPIFIL
RLATEVNWDEEKECFKSLSKECAMFYSIRKQYISEESTLSGQQSEVPGSIPNSWKWTVEH
IVYKALRSHILPPKHFTEDGNILQLANLPDLYKVFERC
NT seq 2277 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttcgtggctggggttattcggcggctggacgagacggtggtgaaccgcatcgcg
gcgggggaagttatccagcggccggctaatgctattaaagagatgattgagaactgttta
gatgcaaaatccacaagtattcaagtggttgttaaagagggaggcctgaagttgattcag
atccaggacaatggcactgggatcaggaaagaagatctggatattgtatgtgagaggttc
actacgagtaaactacagtcctttgaggatttagccagtatttccacctatggctttcga
ggtgaggctttggccagcataagccatgtggctcatgttactattacaacaaaaacagct
gatggaaagtgtgcatacagagcaagttactcagatggaaaactgaaagctcctcctaaa
ccatgtgctggcaatcaagggacccagatcacagtggaggaccttttttacaacatagcc
acgaggagaaaagctttaaaaaatccaagtgaagaatatgggaagattttggaagttgtt
ggcaggtattcaatacacaattcaggcattagtttctcagttaagaaacaaggagagaca
gtagctgatgttaggacactacccagtgcctcaaccgtggacaatattcgctccatcttt
ggaaatgctgtcagtcgagaactgatagaaattggatgtgaggataaaaccctagccttc
agaatgaatggttacatttccaatgcaaactactcggtgaagaagtgcatcttcttactc
tttatcaaccatcgtctggtagaatcaacttccttgagaaaagctatagaaacggtgtat
gcagcctatttgcccaaaaacacacacccattcctatacctcagtttagaaatcagtccc
cagaatgtggatgttaatgtgcatcccacaaagcacgaagttcacttcctgcacgaggag
agcatcctggagcgggtgcagcagcacatcgagagcaagctcttgggctccaattcctcc
aggatgtacttcacccagactttgctgccaggactcgctggcccctctggggagatggtt
aaatccacaacaagtctgacctcctcttctacttctggaagtggtgataagctctatgcc
caccagatggttcgtacagattcccgagaacagaagcttgatgcatttctgcagcctctg
agcaaaccactgtccagtcagccccaggccattgtcccagaggataagacagatatttct
agtggcggggctaggcagcaagatgaggagatgcttgaactcccagcccctgctgaaatg
gctgccaaaaatcagagcctggagggggatacaacaaaggcgacttcagaaatgtcggag
aagagagggcctacttccaggccaggcaatcccagaaagagacatcgggaagattctgat
gtggatatggtggaagatgattcccgaaaggacatgactgcagcctgtaccccccggaga
aggatcattaacctcaccagtgttttgagtctccaggaagaaattaatgagcgaggacat
gagattctccgcgagatgctgcatgaccattccttcgtgggctgtgtgaatcctcagtgg
gccttggcacagcatcagaccaagctataccttctcaacaccaccaagcttagtgaagaa
ctgttctaccagatactcatttatgattttgccaattttggtgtcctgaggttatcggag
ccagcaccgctctttgacctcgccatgcttgctttagatagtccagagagtggctggaca
gaggaagatggtcctaaagaaggacttgctgaatacattgttgagtttctgaagaagaag
gctgagatgcttgcagactatttctctttggaaattgatgaggaagggagcctgattgga
ttaccccttctgattgacaactatgtgccccctttggagggactgcctatcttcattctt
cgactagctactgaggtgaattgggacgaagaaaaggaatgtttcaaaagcctcagtaaa
gaatgtgctatgttctactccatccggaagcagtacatatctgaggagtcgaccctctca
ggccagcagagtgaagtgcctggctccattccaaactcctggaagtggactgtggaacac
attgtctataaagccttgcgttcacacattctgcctcccaaacatttcacagaagatggt
aatatcctgcagcttgctaacctgcctgatctatacaaagtctttgagaggtgctaa

DBGET integrated database retrieval system