KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100406899Help
Entry
100406899         CDS       T03264                                 

Gene name
IL13
Definition
(RefSeq) interleukin 13
  KO
K05435  interleukin 13
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04630  Jak-STAT signaling pathway
cjc04657  IL-17 signaling pathway
cjc04658  Th1 and Th2 cell differentiation
cjc04664  Fc epsilon RI signaling pathway
cjc05200  Pathways in cancer
cjc05310  Asthma
cjc05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    100406899 (IL13)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100406899 (IL13)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100406899 (IL13)
   04657 IL-17 signaling pathway
    100406899 (IL13)
   04664 Fc epsilon RI signaling pathway
    100406899 (IL13)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    100406899 (IL13)
  09163 Immune diseases
   05310 Asthma
    100406899 (IL13)
   05321 Inflammatory bowel disease (IBD)
    100406899 (IL13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100406899 (IL13)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Interleukins
   100406899 (IL13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL13
Motif
Other DBs
NCBI-GeneID: 100406899
NCBI-ProteinID: NP_001254683
Ensembl: ENSCJAG00000013071
UniProt: B0KWP3
Position
2
AA seq 132 aa AA seqDB search
MALWLTMVIALTCLGGLASPGPVPPYTALKELIEELVNITQNQKAPLCNGSMVWSINMTA
GVYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLLVRDTKIEVAQFVKDLLR
HLRKLFHQGTFN
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atggcgctttggttgaccatggtcattgctctcacttgcctcggcggccttgcctcccca
ggccccgtgcctccctatacagccctcaaggagctcattgaagagctggtcaacatcacc
cagaaccagaaggcccccctctgcaatggcagcatggtgtggagcatcaacatgacagct
ggcgtgtactgtgcagccctggaatccctgatcaatgtgtcagggtgcagtgccatcgag
aagacccagaggatgctgagcggattctgcccacacaaggtctcagccgggcagttttcc
agcttgcttgtccgagacaccaaaatcgaagtggcccagtttgtaaaggacctgctcaga
catttaaggaaactttttcaccagggaacgttcaactga

DBGET integrated database retrieval system