KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100406954Help
Entry
100406954         CDS       T03264                                 

Gene name
CXCR4, CXC-R4, CXCR-4
Definition
(RefSeq) C-X-C motif chemokine receptor 4
  KO
K04189  C-X-C chemokine receptor type 4
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04020  Calcium signaling pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04062  Chemokine signaling pathway
cjc04144  Endocytosis
cjc04360  Axon guidance
cjc04670  Leukocyte transendothelial migration
cjc04672  Intestinal immune network for IgA production
cjc04810  Regulation of actin cytoskeleton
cjc05163  Human cytomegalovirus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100406954 (CXCR4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100406954 (CXCR4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100406954 (CXCR4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100406954 (CXCR4)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100406954 (CXCR4)
   04672 Intestinal immune network for IgA production
    100406954 (CXCR4)
   04062 Chemokine signaling pathway
    100406954 (CXCR4)
  09158 Development
   04360 Axon guidance
    100406954 (CXCR4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100406954 (CXCR4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100406954 (CXCR4)
   05163 Human cytomegalovirus infection
    100406954 (CXCR4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cjc04030]
    100406954 (CXCR4)
   04050 Cytokine receptors [BR:cjc04050]
    100406954 (CXCR4)
   04090 CD molecules [BR:cjc04090]
    100406954 (CXCR4)
G protein-coupled receptors [BR:cjc04030]
 Rhodopsin family
  Chemokine
   CXC Chemokine
    100406954 (CXCR4)
Cytokine receptors [BR:cjc04050]
 Chemokine receptors
  CXC Chemokine
   100406954 (CXCR4)
CD molecules [BR:cjc04090]
 Proteins
  100406954 (CXCR4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 CXCR4_N 7TM_GPCR_Srsx DUF4564
Motif
Other DBs
NCBI-GeneID: 100406954
NCBI-ProteinID: XP_002749520
Ensembl: ENSCJAG00000012046
UniProt: Q8HZU1 U3FG72
Position
6
AA seq 352 aa AA seqDB search
MEGISIYTSDNYTEEIGSGDYDSIKEPCFREENAHFNRIFLPTIYSIIFLTGIVGNGLVI
LVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGKFLCKAVHVIYTVNL
YSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFANVSEA
DDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQKRKALKT
TVILILAFFACWLPYYIGISIDSFILLEIIRQGCEFENTVHKWISITEALAFFHCCLNPI
LYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSSFHSS
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggagggcatcagtatatacacttcagataactacaccgaggaaataggttccggggac
tatgactccataaaggaaccctgcttccgggaagaaaatgcccatttcaaccggatcttc
ctgcccaccatctattccatcatcttcttgactggcatagtgggcaatggattggtcatc
ttggtcatgggttaccagaagaaattgagaagcatgacggacaagtacaggctgcacctg
tcagtggccgacctcctgtttgtcatcacgcttcccttctgggcagttgatgccgtggca
aactggtactttgggaagttcctatgcaaggcagtccatgtcatctacacagtcaacctc
tacagcagtgtcctcatcctggccttcatcagtctggaccgctacctggccattgtccac
gctaccaacagtcagaggccaaggaagctgttggctgaaaaggtggtctatgttggcgtc
tggatccctgccctcctgctgactattcccgacttcatctttgccaatgtcagtgaggca
gatgacagatatatctgtgaccgcttctaccccaatgacctgtgggtggttgtcttccag
tttcagcacatcatggttggcctcatcctgcctggtatcgtcatcctgtcctgctattgc
attatcatctccaaactgtcacactccaagggccaccagaagcgcaaggccctcaagacc
acagtcatcctcatcctggctttcttcgcctgttggctgccttactacattgggatcagc
attgactccttcatcctcctggaaatcatcaggcaagggtgtgagtttgagaacactgtg
cacaagtggatttccattacagaggccctagcttttttccactgttgtctgaaccccatc
ctctatgctttccttggagccaaatttaaaacctctgcccagcatgcactcacctctgtg
agcagagggtctagcctcaagatcctctccaaaggaaagcgaggtggacattcatcagtt
tccactgagtctgagtcttcaagttttcactccagctaa

DBGET integrated database retrieval system