KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100407165Help
Entry
100407165         CDS       T03264                                 

Definition
(RefSeq) heat shock 70 kDa protein 1-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc03040  Spliceosome
cjc04010  MAPK signaling pathway
cjc04141  Protein processing in endoplasmic reticulum
cjc04144  Endocytosis
cjc04213  Longevity regulating pathway - multiple species
cjc04612  Antigen processing and presentation
cjc04915  Estrogen signaling pathway
cjc05134  Legionellosis
cjc05145  Toxoplasmosis
cjc05162  Measles
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    100407165
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100407165
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100407165
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100407165
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    100407165
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100407165
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    100407165
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    100407165
  09172 Infectious disease: viral
   05162 Measles
    100407165
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100407165
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cjc01009]
    100407165
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cjc03041]
    100407165
   03009 Ribosome biogenesis [BR:cjc03009]
    100407165
   03110 Chaperones and folding catalysts [BR:cjc03110]
    100407165
   04131 Membrane trafficking [BR:cjc04131]
    100407165
   03051 Proteasome [BR:cjc03051]
    100407165
   03029 Mitochondrial biogenesis [BR:cjc03029]
    100407165
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100407165
Protein phosphatases and associated proteins [BR:cjc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     100407165
Spliceosome [BR:cjc03041]
 Complex B
  Other components
   Prp19 complex
    100407165
 Complex C
   Prp19-CDC5 complex
    100407165
Ribosome biogenesis [BR:cjc03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    100407165
Chaperones and folding catalysts [BR:cjc03110]
 Heat shock proteins
  HSP70 / DNAK
   100407165
Membrane trafficking [BR:cjc04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    100407165
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    100407165
Proteasome [BR:cjc03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    100407165
Mitochondrial biogenesis [BR:cjc03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    100407165
Exosome [BR:cjc04147]
 Exosomal proteins
  Proteins found in most exosomes
   100407165
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C MIF4G DDR Hydantoinase_A Pox_D5
Motif
Other DBs
NCBI-GeneID: 100407165
NCBI-ProteinID: XP_017826467
Position
4
AA seq 438 aa AA seqDB search
MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
LNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEIS
SMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAA
IAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNH
FVEEFKRKHKKDISQNKRALRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRA
RFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLN
NSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRTPPS
PRSRRRSSPPTPTTSPGC
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagccgcggcgatcggcattgacctgggcaccacctactcctgcgtcggggtg
ttccagcacggcaaggtggagatcatcgccaacgaccagggcaaccgcaccacccccagt
tacgtggccttcacggacaccgagcggctcatcggggatgcggccaagaaccaggtggcg
ctgaacccgcagaacaccgtgtttgacgcgaagcggctgatcggccgcaagttcggcgac
ccggtggtgcagtcggacatgaagcactggccgttccaggtgatcaacgacggagacaag
cccaaggtgcaggtgagctacaagggggagaccaaggcgttctaccccgaggagatctcg
tccatggtgctgaccaagatgaaggagatcgccgaggcgtacctgggctatccggtgacc
aacgcggtgatcaccgtgccggcctacttcaacgactcgcagcgccaggccaccaaggat
gcgggggtgatcgcggggctcaacgttctgcggatcatcaacgagcccacggcggccgcc
atcgcctacggcctggaccgaaccggcaagggggagcgcaacgtgctcatctttgacctg
ggcgggggcaccttcgacgtgtccatcctgaccatcgacgacggcatcttcgaggtgaag
gccacggccggggacacccacttgggtggggaggactttgacaacaggctggtgaaccac
ttcgtggaagagttcaagaggaaacacaagaaggacatcagccagaacaagcgagccttg
aggcggctgcgcactgcctgcgagagggccaagaggaccctgtcgtccagcacccaggcc
agcctggagatcgactccctgtttgagggcatcgacttctacacgtccatcaccagggcg
aggttcgaggagctgtgctcggacctgttccgaagcaccctggagcccgtggagaaggct
ctgcgagacgccaagctggacaaggcccagatccacgacctggtcctggtcgggggctct
acccgcatccccaaggtgcagaagctgctgcaggacttcttcaacgggcgcgacctgaac
aatagcatcaaccccgacgaggctgtggcctatggggcggcggtgcaggcagccatcctg
atgggggacaagtccgagaacgtgcaggacctgctgctgctggacgtggctcccctgtcg
ctggggctggagacggccgggggcgtgatgactgccctgatcaagcgcactccaccatcc
ccacgaagcagacgcagatcttcaccacctactccgacaaccagcccggggtgctga

DBGET integrated database retrieval system