KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100407382
Entry
100407382         CDS       T03264                                 
Symbol
SEMA3F
Name
(RefSeq) semaphorin-3F isoform X1
  KO
K06840  semaphorin 3
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100407382 (SEMA3F)
SSDB
Motif
Pfam: Sema Ig_3 I-set PSI ig Ig_6 Ig_2 V-set VP4_haemagglut
Other DBs
NCBI-GeneID: 100407382
NCBI-ProteinID: XP_035131461
Ensembl: ENSCJAG00000004851
Position
15:26496774..26530346
AA seq 784 aa
MLVASLLLWALLTGAWPAFPTQDHLPAMPRVRLSFKELKATGTAHFFNFLLNTTDYRILL
KDEDHDRMYVGSKDYVLSLDLHDINREPLIIHWAASQQRIEECVLSGKDGNGECGNFVRL
IQPWNRTHLYVCGTGAYNPMCTYVNRGRRAQATPWTQVQVVRGRGSRATDGALRPTPTAP
RQDYIFYLEPERLESGKGKCPYDPKLDTASALINEELYAGVYIDFMGTDAAIFRTLGKQT
AMRTDQYNSRWLNDPSFIHAELIPDSSERNDDKLYFFFRERSAEAPQSPAVYARIGRICL
NDDGGHCCLVNKWSTFLKARLVCSVPGEDGIETHFDELQDVFVQQTLDVRNPVIYAVFTS
SGSVFRGSAVCVYSMADIRMVFNGPFAHKEGPNYQWMPFSGKMPYPRPGTCPGGTFTPSM
KSTKDYPDEVINFMRSHPLMYQAVYPLQRRPLVVRTGAPYRLTTVAVDQVDAADGRYEVL
FLGTDRGTVQKVIVLPKDDQELEELMLEEVEVFKDPAPVKTMTISSKRQQLYVASAVGVT
HLSLHRCQAYGAACADCCLARDPYCAWDGQACSRYTASSKRRSRRQDVRHGNPIRQCRGF
NSNANKNAVESVQYGVAGSAAFLECQPRSPQATVKWLFQRDPGDRRREIRAEDRFLRTEQ
GLLLRALQLSDRGLYSCTATENNFKHVVTRVQLHVLGRDAVHAALFPPLAVSALPSPGTG
PPTPPYQELAQLLAQPEVGLIHQYCQGYWRHVPPSPREAPGALRPPESQDQKKPRNRRHH
PPDT
NT seq 2355 nt   +upstreamnt  +downstreamnt
atgcttgtcgccagtcttctcctctgggccctactcactggggcctggccagccttcccc
acccaggatcacctcccggccatgccccgggtcaggctttcattcaaagagttgaaggcc
acaggcaccgcccatttcttcaacttcctgctcaacacaactgactaccgaatcctgctc
aaggacgaggaccacgaccgcatgtatgtgggcagcaaggactacgtgctatccctggac
ctgcacgacatcaaccgcgagcccctcattatccactgggcagcctcccaacagcgtatt
gaggagtgcgtgctctcaggcaaggatggcaacggtgagtgtgggaacttcgtcaggctc
atccagccctggaaccgaacacatctgtatgtgtgcgggacgggtgcctacaaccccatg
tgcacctatgtgaaccgtggccgccgtgcccaggccacaccatggacccaggtgcaggtg
gtcagaggccgaggcagcagagccacggatggtgccctccgcccgacacccacagcccca
cgccaggattacatcttctacctggagcctgagcgactcgagtcagggaagggcaaatgt
ccgtacgaccccaagctggacacagcgtcagccctcatcaatgaggagctctatgctggt
gtgtacatcgattttatgggcactgacgcagccatcttccgcaccctcggaaagcagacg
gccatgcgcacggatcagtataactcccggtggctgaacgacccgtcgttcatccatgct
gagctcattcctgacagctcggagcgtaatgatgataagctctacttcttcttccgtgag
cggtcggcagaggcgccgcagagccccgctgtgtacgcccgcatcggacgcatctgcctg
aatgatgacggtggtcactgttgcctggtcaacaagtggagtacattcctgaaggctcgg
cttgtctgctctgtgccgggcgaggatggcattgagactcacttcgatgagctccaggac
gtgtttgtccagcagaccctggacgtgaggaaccctgtcatttacgctgtctttacctcc
tctggctctgtgttccgaggctctgctgtgtgtgtctactccatggctgacattcgcatg
gtcttcaacgggccctttgcccacaaggaaggccccaactaccagtggatgcccttctca
gggaagatgccctacccacggccgggcacgtgccctggtggaaccttcacgccatccatg
aagtccacgaaggactatcctgatgaggtgatcaacttcatgcgtagccacccgctcatg
tatcaggccgtgtaccctctgcaacggcggcccctggtggtccgcacaggtgctccctac
cgcctcaccactgtcgctgtggaccaggtggatgcagctgatgggcgctatgaggtgctt
ttcctgggcacagaccgcgggacagtacagaaggtcattgtgctgcccaaggatgaccag
gagttggaagagctcatgctggaagaggtggaggtcttcaaggacccagcacccgtcaag
accatgaccatctcttccaagaggcaacaactctatgtggcgtcggctgtgggagtcaca
cacctgagcctgcaccgatgccaggcgtatggggctgcctgtgctgactgctgccttgcc
cgggacccttactgtgcctgggatggccaggcctgctcccgctatacagcatcctccaag
aggcggagccgccggcaggacgtccggcatggaaaccccatcaggcagtgccgtgggttc
aactccaatgccaacaagaatgccgtggagtctgtgcagtatggtgtggctggcagtgcg
gccttccttgagtgccagccccgctcgcctcaagccactgttaagtggctgttccagcga
gatcctggtgaccggcgccgagagattcgtgcagaggaccgtttcctgcgcacagagcag
ggcttgttgctgcgtgccttgcagctcagtgatcgtggcctctactcctgcacagccacg
gaaaacaacttcaagcacgttgtcacacgagtgcagctacatgtactgggccgggacgcc
gtccatgctgcccttttcccaccactggctgtgagcgccctgccatccccaggcacaggc
cccccaacgcctccttaccaggagctggcccagctgctggcccaaccagaagtgggcctc
atccaccagtactgccaaggttactggcgtcatgtgccccccagccctagggaggctcca
ggggcactccggcctcctgagtcccaggaccagaaaaagccccggaaccgccggcaccac
cctccggacacatga

DBGET integrated database retrieval system