KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100407630Help
Entry
100407630         CDS       T03264                                 

Gene name
IL5
Definition
(RefSeq) interleukin 5
  KO
K05428  interleukin 5
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04630  Jak-STAT signaling pathway
cjc04640  Hematopoietic cell lineage
cjc04657  IL-17 signaling pathway
cjc04658  Th1 and Th2 cell differentiation
cjc04660  T cell receptor signaling pathway
cjc04664  Fc epsilon RI signaling pathway
cjc04672  Intestinal immune network for IgA production
cjc05200  Pathways in cancer
cjc05310  Asthma
cjc05320  Autoimmune thyroid disease
cjc05321  Inflammatory bowel disease (IBD)
cjc05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    100407630 (IL5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100407630 (IL5)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100407630 (IL5)
   04660 T cell receptor signaling pathway
    100407630 (IL5)
   04658 Th1 and Th2 cell differentiation
    100407630 (IL5)
   04657 IL-17 signaling pathway
    100407630 (IL5)
   04664 Fc epsilon RI signaling pathway
    100407630 (IL5)
   04672 Intestinal immune network for IgA production
    100407630 (IL5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100407630 (IL5)
  09163 Immune disease
   05310 Asthma
    100407630 (IL5)
   05320 Autoimmune thyroid disease
    100407630 (IL5)
   05321 Inflammatory bowel disease (IBD)
    100407630 (IL5)
   05330 Allograft rejection
    100407630 (IL5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100407630 (IL5)
   00536 Glycosaminoglycan binding proteins [BR:cjc00536]
    100407630 (IL5)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Interleukins
   100407630 (IL5)
Glycosaminoglycan binding proteins [BR:cjc00536]
 Heparan sulfate/Haparin
  Cytokines
   100407630 (IL5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL5 NuiA DUF1418
Motif
Other DBs
NCBI-GeneID: 100407630
NCBI-ProteinID: NP_001244162
Ensembl: ENSCJAG00000013034
UniProt: Q0Z974
Position
2
AA seq 134 aa AA seqDB search
MRMLLHLSLLALGAAHVCANPTARPTSALVKETLALLSIHRPLLMVNETLRIPVPSHKNH
QLCTEEIFQGIGTLENQAVQGSDVEKLFQNLSLIKEHIDRQKKKCGQERRRVKQFLDYLQ
EFLGVINTEWIIES
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgaggatgcttctgcatttaagtttgctagctcttggagctgcccacgtgtgtgccaac
cccacagcacgtcccacaagtgcattggtgaaagagactttggcactgctttctatccat
cgacctctgctgatggtcaatgagaccctgaggattcctgttccttcacataaaaatcac
caactgtgcactgaagaaatctttcagggaataggcacactggagaaccaagctgtgcaa
gggagtgatgtggaaaaactattccaaaacttgtctttaataaaggaacacattgaccgc
caaaaaaaaaagtgtggacaagaaagacgaagagtaaagcaattcctagactacctgcaa
gagtttcttggtgtaatcaacacagagtggataatcgaaagttga

DBGET integrated database retrieval system