KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100407645Help
Entry
100407645         CDS       T03264                                 

Gene name
CYLD
Definition
(RefSeq) CYLD lysine 63 deubiquitinase
  KO
K08601  ubiquitin carboxyl-terminal hydrolase CYLD [EC:3.4.19.12]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04064  NF-kappa B signaling pathway
cjc04217  Necroptosis
cjc04380  Osteoclast differentiation
cjc04622  RIG-I-like receptor signaling pathway
cjc04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100407645 (CYLD)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100407645 (CYLD)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    100407645 (CYLD)
   04625 C-type lectin receptor signaling pathway
    100407645 (CYLD)
  09158 Development
   04380 Osteoclast differentiation
    100407645 (CYLD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cjc01002]
    100407645 (CYLD)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cjc04121]
    100407645 (CYLD)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100407645 (CYLD)
Peptidases [BR:cjc01002]
 Cysteine Peptidases
  Family C67
   100407645 (CYLD)
Ubiquitin system [BR:cjc04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100407645 (CYLD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CYLD_phos_site CAP_GLY UCH COX_ARM
Motif
Other DBs
NCBI-GeneID: 100407645
NCBI-ProteinID: XP_002760989
Ensembl: ENSCJAG00000001749
UniProt: F7CWF7
Position
20
AA seq 956 aa AA seqDB search
MSSGLWSQEKVTSPYWEERTFYLLLQECSVTDKQTQKLLKVPKGSIGQYVQDRSVGHSRI
PSAKGKKNQIGLKILEQPHAVLFVDEKDVVEINEKFTELLLAITNCEERFSLFKNRNRLS
KGLQIDVGCPVKVQLRSGEEKFPGVVRFRGPLLAERTVSGIFFGVELLEEGRGQGFTDGV
YQGKQLFQCDEDCGVFVALDKLELIEDDDTALESDYAGPVDTMQVELPPLEINSRVSLKV
GKTIESGTVIFCDLLPGKESLGYFVGVDMDNPIGNWDGRFDGVQLCSFACVESTILLHIN
DIIPALSESVTQERRPPKLAFMSRGVGDKGSSSHNKPKATGSTSDPGNRNRSELFYTLNG
SSVDSQPQSKSKNTWYIDEVAEDPAKSLTEVSTDFDRSSPPLQPPPVNALSTENRFHSLP
FSLTKMPNSNGSIGHSPLSLSAQSVMEELNTAPVQESPPLAMPPGNSHGLEVGSLAEVKE
NPPFYGVIRWIGQPPGLNEVLAGLELEDECAGCTDGTFRGTRYFTCALKKALFVKLKSCR
PDSRFASLQPVSNQIERCNSLAFGGYLSEVVEENTPPKMEKEGLEIMIGKKKGIQGHYNS
CYLDSTLFCLFAFSSVLDTVLLRPKEKNDVEYYSETQELLRTEIVNPLRIYGYVCATKIM
KLRKILEKVEAASGFTSEEKDPEEFLNILFHHILRVEPLLKIRSAGQKVQDCYFYQIFME
KNEKVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDL
LEDTPRQCRICGGLAMYECRECYDDLDISAGKIKQFCKTCNTQVHLHPKRLNHKYNPVSL
PKDLPDWDWRHGCIPCQNMELFAVLCIETSHYVAFVKYGKDDSAWLFFDSMADRDGGQNG
FNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLYK
NT seq 2871 nt NT seq  +upstreamnt  +downstreamnt
atgagttcaggcttatggagccaagagaaagttacctcgccctactgggaagagcggact
ttttatttgcttcttcaagagtgcagcgttacagacaaacaaacacagaagctgcttaaa
gtgccgaagggaagtataggacagtatgttcaagatcgttctgtggggcattcaaggatt
ccttctgccaaaggcaagaaaaatcagattggattaaaaattctagagcaacctcatgcg
gttctgtttgttgatgaaaaggacgttgtagagataaatgaaaagttcacagagttgctt
ctggcaattaccaattgtgaggagaggttcagcctgtttaaaaacagaaacagactaagt
aaaggcctccaaatagacgtgggctgccctgtgaaagtgcagctgagatctggggaagaa
aaatttcctggagttgtgcgcttcagaggacccctgttagcagagaggaccgtgtccgga
atattctttggagttgaattgctggaagaaggtcgtggccaaggtttcactgacggggtg
tatcaagggaaacagctttttcagtgtgatgaagattgtggtgtgtttgttgcattagac
aagctggaactcatagaagacgacgatactgcgttggaaagtgattacgcaggtccagtg
gacacgatgcaggtcgaacttcctcctttggaaataaactccagagtttctttgaaggtt
ggaaaaacaatagaatctggaacagttatattctgtgatcttttgccaggaaaagaaagc
ttaggatattttgttggtgtggacatggataaccctattggcaactgggatggaagattt
gatggagtgcagctttgtagttttgcatgtgttgaaagtacaattctattgcacatcaat
gatatcatcccagctttatcagagagtgtgacacaggaaaggaggcctcccaaacttgcc
tttatgtcaagaggtgttggggacaaaggttcatccagtcataataaaccaaaggctaca
ggatctacctcagaccctggaaatagaaacagatctgaattattttataccttaaatggg
tcttctgttgactcacaaccacaatccaaatcaaaaaatacctggtacatcgatgaagtt
gcagaagaccctgcaaaatctcttacagaggtgtctacagactttgaccgttcttcacca
ccactccagcctcctcctgtgaacgcactgtccactgagaacagattccactctctacca
ttcagtctcacaaagatgcccaacagcaatggaagtattggccacagtccactttctctg
tcagcccagtctgtgatggaagagctaaacactgcacccgtccaggagagtccacccttg
gccatgcctcctgggaactcacatggtctagaagtggggtcattggctgaagttaaagag
aaccctcctttctatggggtaatccgttggatcggtcagccaccaggactgaatgaagta
ctcgctggactggaactggaagatgaatgtgcaggctgtaccgatggaaccttcagaggc
actcggtatttcacctgtgctctgaagaaggcgctgtttgtgaaactgaagagctgcagg
cctgactctcggtttgcatcactgcagccggtttccaatcagatcgagcgctgtaactct
ttagcatttggaggctacttaagtgaagtagtagaagaaaatactccccccaaaatggaa
aaagaaggcttggagataatgattgggaagaagaaaggcatccagggtcattacaattct
tgttacttagactcaactttattctgcttatttgcttttagttctgttctggacactgtg
ttacttagacccaaagaaaagaatgatgtggaatattatagtgaaacccaagagctgctg
aggacagaaattgttaatcctctgagaatatatggatatgtgtgtgccacaaagattatg
aaactgaggaaaatacttgaaaaggtggaggctgcatcaggatttacctctgaagaaaaa
gatcctgaggaattcttgaatatcctgtttcatcatattttaagggtagaaccattgcta
aaaataagatcagcaggtcaaaaggtacaagattgttacttctatcaaatttttatggaa
aaaaatgagaaagttggagttcccacaattcagcagttgttagaatggtcttttatcaac
agtaacctgaaatttgcagaggcaccatcatgtctgattattcagatgcctcgatttgga
aaagactttaaactatttaaaaaaatttttccttctctggaattaaatataacagattta
cttgaagacactcccaggcagtgccggatatgtggagggcttgcaatgtacgagtgtaga
gaatgctatgatgatctggacatctcagctggaaaaatcaagcagttttgtaaaacctgc
aacactcaagtccaccttcatcccaagaggctgaatcataaatataacccagtgtcactt
cccaaagacttacctgactgggactggagacatggctgcatcccttgccagaatatggag
ttatttgctgttctctgcatagaaacgagccactatgttgcttttgtgaagtatgggaag
gacgactctgcctggctcttctttgacagcatggccgatcgggatggcggtcagaatggc
ttcaacattcctcaagtcaccccatgcccagaagtaggagagtacttgaagatgtctctg
gaagacctccattctttggactccagaagaatccaaggctgtgcacgaagactgctttgt
gacgcgtatatgtgcatgtaccagagtccgacaatgagtttgtacaaataa

DBGET integrated database retrieval system