KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100407653Help
Entry
100407653         CDS       T03264                                 

Gene name
SLC19A1
Definition
(RefSeq) solute carrier family 19 member 1
  KO
K14609  solute carrier family 19 (folate transporter), member 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01523  Antifolate resistance
cjc04977  Vitamin digestion and absorption
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09150 Organismal Systems
  09154 Digestive system
   04977 Vitamin digestion and absorption
    100407653 (SLC19A1)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100407653 (SLC19A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cjc02000]
    100407653 (SLC19A1)
Transporters [BR:cjc02000]
 Solute Carrier Family (SLC)
  SLC19: Folate/thiamine transporter
   100407653 (SLC19A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Folate_carrier
Motif
Other DBs
NCBI-GeneID: 100407653
NCBI-ProteinID: XP_008985065
UniProt: U3F367
Position
21
AA seq 585 aa AA seqDB search
MVPSSPAVEKQVPVEPGPDLELRSWRCLVCYLCFYGFMAQIRPGESFITPYLLGLDKNFT
RKQVTNEITPVLSYSYLAVLVPAFLLTDYLRYTPVLLLQGLSYVAVWLLLLLGRTVAHMQ
LMELFYSITMAARIAYSSYIFSLVQPARYQRVASYSRAAVLLGVFTSSVLGQLLVTAAGV
SFSTLNYISLAFLTFSVVLALFLKRPKRSLFFNRGAAGREPSASASELERMNPGAGGKLG
RALRAVCGDSVLARMLRELGNSLRRPQLRLWSLWWVFNSAGYYLVVYYVHILWNEVEPTT
NSVRVYNGGADAASTLLGAITSFAAGFVKIRWARWSKLLVAGVTATQAGLVFLLSYTRHI
WLCYAAFVLFRGSYQFLVPIATFQIAASLSKELCALVFGVNTFFATIVKTIITFIVSDIR
GLGLPVRQQFQLYSVYFLLLSIIYFLGAALDGLRHCQRGRHQPLPLAEDLRSPAEEKAAL
ALSVQDKDLRSLPPAQSLRLSPEDGLGAAGPGSGEQRQSDLAPAPQAAGFLSPVPAPSAH
TPGSAQASGPDSAAETCPQPAVHPPGVGTLGLQRHLSVSVQNVSQ
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggtgccctccagcccagcagtggagaagcaggtgcccgtggagcctgggccagacctc
gagctccggtcctggcggtgcctggtgtgctacctctgcttctatggcttcatggcgcag
atccggccaggagagagcttcatcacaccctacctcctggggctggacaagaacttcact
cggaagcaggtcaccaacgagatcaccccggtgctctcctactcctacttggccgtgctg
gtgcccgcgttcctgctcactgactacctgcgctacacgcccgtgctgctgctgcagggc
ctgagctacgtggccgtgtggctgctgctgctgctgggccgcaccgtggcgcacatgcag
ctcatggagctcttctacagcatcaccatggccgcgcgcatcgcctactcctcctacatc
ttctcgctggtgcagcccgcgcgctaccagcgcgtggccagctactctcgtgcggcggtg
ctgctgggcgtcttcaccagctcagtgctgggccagctgctggtcaccgctgctggggtc
tccttctccacgctcaactacatctcgctggccttcctcaccttcagcgtggtcctcgcc
ctcttcctcaagcgccccaagcgcagcctcttcttcaaccgcggcgccgcagggcgggaa
ccctcggcctccgcctcggagctggagcgcatgaaccccggagcgggcgggaagctgggg
cgcgcgctgcgggcggtctgcggggactccgtgctggcgcgcatgctgcgggagctgggg
aacagcctgcggcggccgcagctgcgcctctggtccctctggtgggtcttcaactccgcc
gggtactacctggtggtctactacgtgcacatcctgtggaacgaggtggaacccaccacc
aacagcgtgcgggtctacaacggcggggccgacgccgcctccacgctgctgggtgccatc
acctccttcgccgctggcttcgtgaagatccgctgggcacgatggtccaagctgctcgtc
gcgggcgtcacggccacgcaggcggggttggtcttccttctgtcttacacccgccacatc
tggctgtgctacgcggccttcgtgctcttccgcggctcctaccagttcctcgtgcccatc
gccacctttcagatcgcggcttctctgtctaaagaactctgcgccctggtctttggggtc
aacacgttctttgccaccattgtcaagaccatcatcaccttcatcgtctcagacatccgg
ggcctgggcctccccgtccgccagcagttccagttatactctgtgtacttcctgctcctg
tccatcatctacttcctgggggccgcgctggatggcctgcggcattgccaacggggacgc
caccagccgctgccgctggccgaggacctgaggagtcccgcagaggagaaggctgcactg
gcactgagcgtgcaggacaaggacctcagaagcctgccgccagcccagagcctgaggctc
tccccggaagatggcttgggggctgcggggccgggctctggggagcagagacagagcgac
ctagccccggccccacaggcggctggattcctgagcccagtgccagccccttccgcccac
actccgggctctgcccaagcctcaggccctgactctgcagctgagacctgtccccagccg
gctgtccatcctcctggcgtcgggacgctgggtctgcagcgtcatttaagtgtcagcgtt
cagaatgtgagccagtga

DBGET integrated database retrieval system