KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100407781
Entry
100407781         CDS       T03264                                 
Symbol
CNOT3
Name
(RefSeq) CCR4-NOT transcription complex subunit 3
  KO
K12580  CCR4-NOT transcription complex subunit 3
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    100407781 (CNOT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cjc03019]
    100407781 (CNOT3)
Messenger RNA biogenesis [BR:cjc03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     100407781 (CNOT3)
  mRNA degradation factors
   3'-5' decay
    Ccr4-NOT complex
     100407781 (CNOT3)
SSDB
Motif
Pfam: Not3 NOT2_3_5
Other DBs
NCBI-GeneID: 100407781
NCBI-ProteinID: XP_008986883
Ensembl: ENSCJAG00000001094
Position
22:45390119..45409785
AA seq 692 aa
MADKRKLQGEIDRCLKKVSEGVEQFEDIWQKLHNAANANQKEKYEADLKKEIKKLQRLRD
QIKTWVASNEIKDKRQLIDNRKLIETQMERFKVVERETKTKAYSKEGLGLAQKVDPAQKE
KEEVGQWLTNTIDTLNMQVDQFESEVESLSVQTRKKKGDKDFLYDDLDLEDIPQALVATS
PPSHSHMEDEIFNQSSSTPTSTTSSSPIPPSPANCTTENSEDDKKRGRSTDSEVSQSPAK
NGSKPVHSNQHPQSPAVPPTYSSGPPPTASALSATPGNNGAPAPAAPPSALGPKASPAPS
HNSGTPAPYAQAVAPPAPSGPSTTQPRPPSVQPSGGGGGGGGGGGSSSNSNSSAGGGAGK
QNGATSYSSVVADSPAEVALSSSGGNNANSQALGPPSGPHNPPPSTSKEPSAAAPTGAGG
VAPGSGNNSGGPSLLVPLPVNPPSSPTPSFSDAKAAGALLNGPPQFSTTPEIKAPEQTLS
SLKSMAERAAISSGIEDPVPTLHLTERDIILSSTSAPPASAQPPLQLSEVNIPLSLGVCP
LGPVPLTKEQLYQQAMEEAAWHHMPHPSDSERIRQYLPRNPCPTPPYHHQMPPPHSDTVE
FYQRLSTETLFFIFYYLEGTKAQYLAAKALKKQSWRFHTKYMMWFQRHEEPKTITDEFEQ
GTYIYFDYEKWGQRKKEGFTFEYRYLEDRDLQ
NT seq 2079 nt   +upstreamnt  +downstreamnt
atggcggacaagcgcaaactccaaggtgagattgatcgctgcctcaagaaggtgtccgag
ggcgtggagcagtttgaagatatttggcagaagctccataatgcagccaacgcgaaccag
aaagaaaagtatgaggctgacctaaagaaggagattaagaagctacaacggctgagggac
cagatcaagacatgggtagcatccaatgagatcaaggacaagaggcagcttatagacaac
cgcaagctcattgagacgcaaatggagcggttcaaagttgtggagcgagagaccaaaacc
aaagcttacagcaaggagggcctgggcctggcccagaaggtggaccctgcccagaaggag
aaggaggaggtcggccagtggctcacgaataccattgacacgctcaacatgcaggtggac
cagtttgagagtgaagtggagtcactgtcagtgcagacacgcaagaagaagggcgacaag
gattttctctatgatgacctggacctcgaggacattccacaggcgctggtcgccacctcc
ccccccagccacagccacatggaggatgagatcttcaaccagtccagcagcacacccacc
tcgaccacctccagctctcccatccctcccagcccagccaactgtaccacggaaaactct
gaagatgacaagaagagggggcgttccacagatagtgaagtcagccagtctccagccaaa
aacggctccaagcctgtccacagcaaccagcaccctcagtccccagctgtgccacccacc
tattcctctggccccccacccactgcctctgccttgagtgccacccctggcaacaatggg
gcccctgccccagcagcacccccaagtgccctgggccccaaggccagtccagctcccagc
cacaactcgggcacccctgccccctatgcccaggctgtggccccaccagctcccagtggg
cccagcaccacccagccccggccccccagcgtccagcctagtggaggcggtggaggtggc
ggcggaggcggagggagcagcagcaatagtaacagcagtgccggtggaggggctggcaag
cagaatggcgccaccagttacagctcagttgtagcagacagcccagcagaggtggctttg
agcagcagtgggggcaacaatgccaacagccaggccctgggccccccttccggcccccac
aacccacctcccagcacctcgaaggaacccagtgcggcagccccaacaggggctgggggc
gtggccccaggctcagggaacaactcggggggacccagtctcctggtgccactgcctgtg
aatcctcccagctccccaacgcccagcttcagtgatgccaaggcagctggtgccctgctc
aatgggcctccgcagttcagcaccaccccggaaatcaaggccccagagcaaactttgagc
tccttgaagtccatggcagaacgggcagccatcagctctggcattgaggatcccgtgcca
acgctgcacctgactgagcgagacatcatcctcagtagcacatcagcacctccggcctca
gcccagccacccttgcagctgtcagaggtcaacataccgctgtcgctgggtgtctgtcca
ctgggccctgtgcccctcaccaaggagcagctctaccagcaggccatggaagaggccgcc
tggcaccacatgcctcatccctctgattctgagcgtatccggcagtaccttccccggaac
ccctgtccgacacccccctaccaccaccagatgccacccccacactcggacactgtggag
ttctaccagcgcctgtcgactgagacactcttcttcatcttctactatctggagggcact
aaggcacagtacctggcagccaaggccctaaagaagcagtcgtggcgattccacaccaag
tacatgatgtggttccagaggcacgaggagcccaagaccatcactgatgagtttgagcag
ggcacctacatctactttgactacgagaagtggggccagcggaagaaggaaggcttcacc
tttgagtaccgctacctggaggaccgggacctccagtga

DBGET integrated database retrieval system