KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100407865Help
Entry
100407865         CDS       T03264                                 

Gene name
HEXB
Definition
(RefSeq) hexosaminidase subunit beta
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00511  Other glycan degradation
cjc00520  Amino sugar and nucleotide sugar metabolism
cjc00531  Glycosaminoglycan degradation
cjc00603  Glycosphingolipid biosynthesis - globo and isoglobo series
cjc00604  Glycosphingolipid biosynthesis - ganglio series
cjc01100  Metabolic pathways
cjc04142  Lysosome
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    100407865 (HEXB)
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    100407865 (HEXB)
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    100407865 (HEXB)
   00604 Glycosphingolipid biosynthesis - ganglio series
    100407865 (HEXB)
   00511 Other glycan degradation
    100407865 (HEXB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    100407865 (HEXB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:cjc03110]
    100407865 (HEXB)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     100407865 (HEXB)
Chaperones and folding catalysts [BR:cjc03110]
 Intramolecular chaperones
  Others
   100407865 (HEXB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_20 Glycohydro_20b2 Glyco_hydro_20b
Motif
Other DBs
NCBI-GeneID: 100407865
NCBI-ProteinID: XP_008990182
Ensembl: ENSCJAG00000016664
Position
2
AA seq 553 aa AA seqDB search
MELRGLGLLRLPMLLALLLATLLTAMLALLTQLALVAQAARAPGVLAQPRPALWPLPLSV
KMTPNLLRLAPENFYISHSPNSTAGPSCTLLEEAFRRYHDYIFGFYKLHHEPAEFQARTQ
LQQLLVSITLQSECDAFPSISSDESYTLLVKEPVAVLKANRVWGALRGLETFSQLVYQDS
YGTFTINESTIIDSPRFSHRGILIDTSRHYLPVKIILKTLDAMAFNKFNVLHWHIVDDQS
FPYQSIAFPELSNKGSYSLSHIYTPNDVHMVIEYARLRGIRVLPEFDTPGHTLSWGKGQK
DLLTPCFNRKNKLDSFGPINPILHTTYSFLTTFFKEISEVFPDQFIHLGGDEVEFKCWES
NPKIQDFMRQKGFGTDFKQLESFYIQKLLDIIATIKKGSIVWQEVFDDKVKLEPGTIVEV
WKDSGYPQELSRVTASGFPVILSAPWYLDLISYGQDWRKYYKVEPLDFGGTQEQKQLVIG
GEACLWGEYVDATNLTPRLWPRASAVGERLWSSKDVRNMDDAYDRLTRHRCRMVKRGIAA
QPLFAGYCNHENM
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggagctgcgcgggctggggctgctccggctgcccatgctgctggcgctgctgttggcg
acgctgctgacggcaatgttggcgctgcttactcagctggcgctggtggcgcaggcggct
cgggccccgggtgtcttggctcagccccggccggcgctgtggcccctgccgctctcggtg
aagatgaccccgaacctgctgcgcctcgccccggagaacttctacatcagccacagcccc
aattccacggcgggcccctcctgcaccctattggaggaagcgtttcggcgatatcatgac
tacatttttggtttctacaagttgcatcatgaacctgctgaattccaggctagaacccag
cttcagcaacttcttgtctcaatcacccttcagtcagagtgtgatgctttccccagcata
tcttcagatgagtcttatactttacttgtgaaagaaccagtggctgtcctgaaggccaac
agagtttggggagcattacgaggtttagagacctttagccagttagtttatcaagattct
tatgggactttcaccatcaatgaatctaccattattgattctccaaggttttctcataga
ggaattttaattgatacatccagacactatctgccagttaagattattcttaaaactctg
gatgccatggcttttaataagtttaatgttcttcactggcacatagttgacgaccagtct
ttcccctatcagagcatcgcttttcctgagttaagcaataaaggaagctattctttgtct
cacatttatacaccaaatgatgtccatatggtgattgaatatgccagattacgaggaatt
cgagtcctgccagaatttgatacccctggacatacattatcttggggaaaaggtcagaaa
gacctcctgactccatgtttcaatagaaaaaacaagttggactcttttggacctataaac
cctattctgcatacaacatacagcttccttactacatttttcaaagaaattagtgaggtg
tttccagatcagttcattcatttgggaggagatgaagtggaatttaaatgttgggaatca
aatccaaaaattcaagacttcatgaggcaaaaaggctttggcacagattttaaacaactt
gaatctttctacattcaaaagcttttggatattattgcaaccataaaaaagggatccatt
gtctggcaggaggtttttgatgataaagtgaagcttgagccgggcacaatagttgaagtg
tggaaagacagcgggtatcctcaggaactcagcagagtcacagcgtctggcttccctgta
atcctttctgctccttggtacttagatttgattagttatggacaagattggaggaaatat
tataaagtggaacctcttgactttggtggtactcaggaacagaaacaacttgtcattggt
ggagaagcttgtctgtggggagaatatgtggatgcaactaacctcactccaagattatgg
cctcgggcaagtgctgttggtgagagactctggagttccaaggatgtcagaaatatggat
gatgcctatgacagactgacaaggcaccgctgcagaatggtcaaacgtggaatagctgca
caacctctttttgctggatattgtaaccatgagaacatgtaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100414672Help
Entry
100414672         CDS       T03264                                 

Gene name
HEXA
Definition
(RefSeq) hexosaminidase subunit alpha
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00511  Other glycan degradation
cjc00520  Amino sugar and nucleotide sugar metabolism
cjc00531  Glycosaminoglycan degradation
cjc00603  Glycosphingolipid biosynthesis - globo and isoglobo series
cjc00604  Glycosphingolipid biosynthesis - ganglio series
cjc01100  Metabolic pathways
cjc04142  Lysosome
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    100414672 (HEXA)
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    100414672 (HEXA)
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    100414672 (HEXA)
   00604 Glycosphingolipid biosynthesis - ganglio series
    100414672 (HEXA)
   00511 Other glycan degradation
    100414672 (HEXA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    100414672 (HEXA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:cjc03110]
    100414672 (HEXA)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     100414672 (HEXA)
Chaperones and folding catalysts [BR:cjc03110]
 Intramolecular chaperones
  Others
   100414672 (HEXA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_20 Glycohydro_20b2 Glyco_hydro_20b
Motif
Other DBs
NCBI-GeneID: 100414672
NCBI-ProteinID: XP_002753354
Ensembl: ENSCJAG00000018254
UniProt: F6TCZ5
Position
10
AA seq 597 aa AA seqDB search
MQTLCTPRYEQREPHLQAGSERAGSGSSRGRRRRAASDHVIRRWSRGRRSPDQGPTWPAP
SKRGDRRAMASSGLWFSLLLAAAFVGRVTALWPWPQNIQTSDRSYVLYPNNFQFQYDVSS
AAQPGCSVLDEAFRRYRDLLFGSGSWPRPYLTGKQHILEKNVLVVSVVTPGCNQLPTLES
VENYTLSINDDQCLLLSKTVWGALRGLETFSQLVWKSAEGTFFINKTEIEDFPRFPHRGL
LLDTSRHYLPLSSILDTLDVMAYNKLNVFHWHLVDDPSFPYESFTFPELTRKGSYNPVTH
IYTAQDVKEVIEYARLRGIRVLAEFDTPGHTLSWGPGIPGLLTPCYSGSEPSGTFGPVNP
SLNKTYDFMSTFFLEVSSVFPDFYLHLGGDEVDFTCWKSNPDIQDFMKKKGFGEDFKQLE
SFYIQTLLDIVSSYGKGYVVWQEVFDNKVKVRPDTIIQVWREETPVNYTKELELVTKAGF
RALLSAPWYLNRISYNPDWKEFYLVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNLVPR
LWPRAGAVAERLWSNKLTSDLTFAYERLSHFRCELLRRGVQAQPLNVGYCEQEFEQT
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgcagacgctctgcacgccccgctacgagcagcgggagccccacctccaggccggaagt
gaaagggcagggagtgggtcctcccggggtcgcaggcgcagagccgcctctgatcacgtg
atacgccgatggtcacgggggcgccgctcacctgaccagggtcccacgtggccagccccc
tccaagaggggtgaccggcgggccatggcgagctccgggctttggttttcgctgctgctg
gcggcagcgttcgttgggcgggtgacggccctatggccctggccccagaacatccaaacc
tccgaccggagctacgtcctttacccgaacaactttcaattccagtatgatgtcagttcg
gccgcgcagcccggctgctccgtcctcgatgaggccttccgacgctatcgggacctgctt
ttcggttccgggtcttggccccgtccttacctcacaggaaaacagcatatcctggagaag
aatgtgttggttgtctctgtagtcacacctggatgtaaccagcttcctactttggagtcg
gtggagaactataccctgagcataaatgatgaccagtgtttactcctctctaagactgtc
tggggagctctccgaggtctggagacttttagccagcttgtttggaaatctgctgagggc
acattctttatcaacaagactgagatcgaggactttccccgctttcctcaccgaggtttg
ctgttggatacgtctcgccattacctgccactctctagcatcctggacactctggatgtc
atggcgtacaataaattgaacgtgttccactggcatctggtagatgatccttccttccca
tatgagagcttcacttttccagagctcaccagaaaggggtcctacaaccctgtcacccac
atctatacagcacaggacgtgaaggaggtcattgaatacgcacggctccggggtatccgt
gtgcttgcagagtttgacactcccggccacactttgtcctggggaccaggtatccctgga
ttattgactccttgctactctgggtctgagccctctggcacctttggaccagtgaatccc
agtctcaacaagacctatgacttcatgagcacattcttcttggaggtcagctctgtcttc
ccagatttttatcttcatcttggaggagatgaggttgatttcacctgctggaagtccaac
ccagatatccaggactttatgaaaaagaaaggcttcggtgaggacttcaagcagctggag
tccttctacatccagacgctgctggacatcgtctcttcttatggcaagggctatgtggtg
tggcaagaggtgtttgataataaagtaaaggttcggccggacacaattatacaggtgtgg
cgagaagagactccagtgaactatacgaaggaactggaactggtcaccaaggccggcttc
cgggcccttctctccgctccctggtacctgaaccgtatatcctacaaccctgactggaag
gagttctacctagtggaacccctggcatttgaaggtacccctgagcagaaggctctggtg
attggtggagaggcctgtatgtggggagaatatgtggacaacacaaacctggtccccagg
ctctggcccagggcaggggctgttgccgaaaggctgtggagcaacaagttgacatctgac
ctgacatttgcctatgaacgtttgtcacactttcgctgtgagttgctgaggcgaggtgtc
caggcccagcccctcaatgtaggctactgtgagcaggagtttgaacagacctga

DBGET integrated database retrieval system