KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100407990Help
Entry
100407990         CDS       T03264                                 

Gene name
IRF1
Definition
(RefSeq) interferon regulatory factor 1
  KO
K09444  interferon regulatory factor 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04625  C-type lectin receptor signaling pathway
cjc04668  TNF signaling pathway
cjc04917  Prolactin signaling pathway
cjc05133  Pertussis
cjc05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100407990 (IRF1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100407990 (IRF1)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100407990 (IRF1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05133 Pertussis
    100407990 (IRF1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100407990 (IRF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cjc03000]
    100407990 (IRF1)
Transcription factors [BR:cjc03000]
 Eukaryotic Type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    100407990 (IRF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IRF
Motif
Other DBs
NCBI-GeneID: 100407990
NCBI-ProteinID: XP_002744654
Ensembl: ENSCJAG00000013013
UniProt: B0KWP0
Position
2
AA seq 324 aa AA seqDB search
MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAI
HTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLPPLNKNQR
KERKSKSSRDKSKVKRKLCGDSSPDTFSDGLSSSTLPDDHSSYTTPGYMQDLEVERALTP
ALSSCGVSSTLPDWHIPVEVVPDSTSDLYNFQVSPMPSTSEAATDEDEEGKLPEDIMKLL
EQSEWQPTNVDGKGYLLNEPGVQPTSVYGDFSCKEEPEVDSPGGDIGLSLQRVFTDLKNM
DTTWLDSLFTPVRLPSIQAIPCAP
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgcccatcactcggatgcgcatgagaccctggctagagatgcagattaattccaaccaa
atcccggggctcatctggattaataaagaggagatgattttccagatcccatggaagcat
gccgccaagcatggctgggacatcaacaaggatgcctgtttgttccggagctgggccatt
cacacaggccgatacaaagcaggggaaaaggagccagaccccaaaacatggaaggccaac
tttcgctgtgccatgaactccctgccagatattgaggaggtgaaggaccagagcaggaac
aagggtagttcagctgtgcgggtgtaccggatgcttccacctctcaacaagaaccagaga
aaagaaagaaagtcgaagtccagccgagataagagcaaggtcaagaggaagttatgtggg
gattccagccctgataccttctctgatggactcagcagctccactctgcctgatgaccac
agcagctatacaactccgggctacatgcaggacttggaggtggagcgggccctgactcca
gcactgtcgtcgtgtggtgtcagcagcactctccccgactggcacatcccagtggaagtt
gtgccggacagcaccagtgatctgtacaacttccaggtgtcacctatgccctccacttct
gaagctgcaacagatgaggatgaggaagggaaattacctgaggacatcatgaagctcttg
gagcagtcagagtggcagccgacaaacgtggatgggaaggggtacctactcaatgaacct
ggagtccagcccacctctgtctatggagactttagctgcaaggaggagccagaagttgac
agcccagggggtgatattgggctgagtctacagcgtgtcttcacagatctgaagaacatg
gataccacctggctggacagcctgtttactccagtccggttgccctccattcaggctatt
ccctgtgcaccgtag

DBGET integrated database retrieval system