KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100408177Help
Entry
100408177         CDS       T03264                                 

Gene name
LEPR
Definition
(RefSeq) leptin receptor
  KO
K05062  leptin receptor
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04080  Neuroactive ligand-receptor interaction
cjc04152  AMPK signaling pathway
cjc04630  Jak-STAT signaling pathway
cjc04920  Adipocytokine signaling pathway
cjc04932  Non-alcoholic fatty liver disease (NAFLD)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    100408177 (LEPR)
   04152 AMPK signaling pathway
    100408177 (LEPR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100408177 (LEPR)
   04060 Cytokine-cytokine receptor interaction
    100408177 (LEPR)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100408177 (LEPR)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100408177 (LEPR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:cjc04050]
    100408177 (LEPR)
   04090 CD molecules [BR:cjc04090]
    100408177 (LEPR)
Cytokine receptors [BR:cjc04050]
 Interleukin receptor families
  Prolactin receptor family
   100408177 (LEPR)
CD molecules [BR:cjc04090]
 Proteins
  100408177 (LEPR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ObR_Ig Lep_receptor_Ig fn3
Motif
Other DBs
NCBI-GeneID: 100408177
NCBI-ProteinID: XP_008999662
Ensembl: ENSCJAG00000016945
Position
7
AA seq 1165 aa AA seqDB search
MICQKFYVVLLPWEFIYVITASNLSYPITPWRFKLSCMPPNKTYDYFRLPAGLSKNTSDL
NGHYEKAVEVKFNSSGTHFSNLSKTTFHCCFRSEQDINSSLCADNIEGKTFFSTVNSLGF
QQIGANWNIQCWLKGDLKLFICNVESLFKNQFKNYNHKVHLLYVLPEVLEDSPLVPQKGS
FQIVQCNCSVHKCCECLVSVPTAKLNDTLLMYLKITSGGVIFQSPLMSVQPINVVKSDPP
LGLHMEITDDGNLKISWSSPPLVGFPLQYQVKYSENSSTVIREADKIASATSLLVDSVHP
GSSYEVQVRGKRLDGPGIWSDWSTPHVFTTQDVIYFPPKILTSVESNVSFHCIYKNENKI
VSSKKIVWWMNLAEKIPQSQYDVVSDHVSKVTFFNLNATKPRGKFTYDAVYCCNEHECHH
HYAELYVIDVSINISCETDGSLTKMTCRWSTNTIQSLAGSTLQLRYYRSRLYCSDSPSIY
PISEPKDCHLQRDGFYECIFQPIFLLSGYTMWIRINHSLGSLDSPPTCVLPNSVVKPLPP
SSVKAEITVKTGLLKISWENPVFPETNLQFQIRYGLTGKEVQWKIYEVYDATSKYVSLPV
PDLCAVYVVQVRCKRLDGLGYWSNWSSPAYTVVMDIKVPMRGPEFWRKINGDTMKKEKNV
TLLWKPLMKRDSLCSVQRYVINHHTSLNGTWSEDVGNHTKYTFLWTEQEHTVTVLAINSV
GDSVANFNLTFSWPMSKVNIIQSLSAYPLNSSCVILSWMLSPSDYKPMSFIIEWKNLNED
DEIKWLRISSSVKKCYIHDHFIPIEKYQFSLYPIFMEGVGTPKIINSFTQDDIEKHQNDA
GLYVIVPVIISSFILLLGTLFISHQRMRKLIWEDVPNPKKCSWAQGLNFQKPETFEHLFI
KHTESVTFRPLLLEPEAISEDISVDTSWKNKDEMVPTTVVSLLPTTDLEKGSVCISDQFN
SSNFSEAEGTKVTCEDESRRQPFVKYAMLVSNSKLGETDEEQGLINSSVSKCFSSKNYPL
KDSFSNSSWEIEAQAFFILSDQHLNIISPHLTFSEGLDDLLKLEGNFPEENNDEKSICYL
GVTSIKKRESDMLLTDKSRVLCPFLDPRLFTDIRVLQDSCSHFVENNFNLGISSKKAFVS
YMPQFQTCSTQTRKIMENKMCDLTV
NT seq 3498 nt NT seq  +upstreamnt  +downstreamnt
atgatttgtcaaaaattctatgtggttttgttaccctgggaatttatttatgtcataact
gcatctaacttgtcatatccaatcactccttggagatttaagttgtcttgcatgccacca
aataaaacttatgactacttccgtttgcctgctggactctcaaagaatacttcagatttg
aatggacattatgagaaagctgttgaagttaagtttaattcaagtggaacccacttttct
aacttatctaaaacaactttccactgttgctttcggagtgagcaagatataaactcctca
ttatgtgcagacaacattgaaggaaagacatttttttcaacagtaaattctttaggtttt
caacaaataggtgcaaactggaacatacagtgctggctaaaaggagacttgaaattattc
atctgtaatgtggagtcattatttaagaatcaatttaagaattataaccataaggtccat
cttttatatgttctgcctgaagtattagaagattcacctctggttccccaaaaaggcagt
tttcagattgttcagtgcaactgcagtgttcacaaatgttgtgaatgtctcgtgtctgtg
ccaacagccaaactcaacgacactcttctcatgtatttgaaaatcacatctggtggagta
atttttcagtcacctctaatgtcagttcagcccataaatgtggtgaagtctgatccacca
ttaggtttgcatatggaaatcacagatgatggtaatttaaagatttcttggtccagccca
ccattggtaggatttccacttcaatatcaagtgaaatactcagagaattcttcaacagtt
atcagagaagctgacaagattgcctcagctacatccctgctggtagacagtgtacatcct
gggtcttcatatgaggttcaggtgaggggcaaaagactggatggcccaggaatctggagt
gactggagtactcctcatgtctttaccacacaagatgtcatatactttccacctaaaatt
ctgacaagtgttgagtctaatgtttcttttcactgcatctataagaatgaaaacaagatt
gtttcctcaaaaaagattgtttggtggatgaatttagctgagaaaattcctcaaagccag
tatgatgttgttagtgatcatgttagcaaagttacttttttcaatctgaatgcaaccaaa
cctcgaggaaaatttacctatgacgcagtgtactgctgcaatgaacatgaatgccatcat
cactatgctgaattatatgtgattgatgtcagtatcaatatctcatgtgaaactgatggg
agcttaactaaaatgacttgcagatggtcaaccaatacaatccaatcacttgcgggaagc
actttgcaattgaggtattatcggagcagactttactgttctgatagtccatctatttat
cccatatctgaacccaaagattgccatttgcagagggatggtttttatgaatgcattttc
cagccaatctttctattatccggctatacaatgtggattaggatcaatcactctctaggt
tcacttgactctccgccaacatgtgtccttcctaattctgtggtgaagccactgcctcca
tccagtgtgaaagcagaaattactgtaaaaactggattattgaaaatatcttgggaaaac
ccagtctttccagagactaatcttcaattccagattcgctatggtttaactggaaaagaa
gtacaatggaagatatatgaggtttatgatgcaacatcaaaatatgtcagtctaccagtt
ccagacctgtgtgcagtctatgttgttcaggtgcgctgtaagaggctagacggactggga
tactggagtaattggagcagtccagcctacacagttgtcatggatataaaagttcctatg
agaggacctgaattttggagaaaaattaatggagatactatgaaaaaagagaaaaatgtc
actttactttggaagcccctgatgaaaagagattcactgtgcagtgtccagagatatgtg
ataaaccatcatacttccctcaatggaacatggtcagaagatgtgggaaatcacactaaa
tacaccttcctgtggacagaacaagagcatactgttacggttctagccatcaattcagtt
ggtgattctgttgcaaattttaatttaaccttttcatggcctatgagcaaagtaaatatc
atccagtcactcagtgcttatcctttaaacagcagttgtgtgattctttcctggatgcta
tcacccagtgactacaagccaatgtcttttattattgagtggaaaaatcttaatgaagat
gatgaaataaaatggcttagaatctcttcatctgttaagaagtgttatatccatgatcat
tttattcccatcgagaagtaccagttcagtctttacccaatatttatggaaggagtggga
acaccaaagataattaatagcttcactcaagatgatattgaaaaacaccaaaatgatgca
ggtttatatgtaattgtgccagtaattatttcctctttcatcttactacttggaacacta
ttcatatcacaccaaagaatgagaaagctgatttgggaagatgttccaaatcccaagaag
tgttcctgggcacaaggacttaattttcagaagccagaaacatttgagcatctttttatc
aagcatacagaatcagtgacatttcgtcctcttcttttggagcctgaagcaatttcagaa
gatatcagtgttgatacatcatggaaaaataaagatgagatggtgccaacaactgtggtc
tctctccttccaacaacagatcttgaaaagggttctgtttgtattagtgaccagttcaac
agttctaacttctctgaggctgagggtaccaaggtaacctgtgaggacgaaagccgaaga
caaccctttgttaaatatgccatgctggtcagcaactctaaactaggtgaaactgatgaa
gaacaagggcttataaatagttcagtcagcaaatgcttctctagcaaaaattatcctctg
aaggattctttctctaatagctcatgggaaatagaggcacaggcattttttatattatca
gatcagcatctcaacataatttcaccacacctcacattctcagaaggattggatgacctt
ttgaaactggagggaaatttccctgaagaaaataatgatgaaaagtctatctgttattta
ggggtcacctcaatcaaaaagagagagagtgatatgcttttgactgacaagtcaagggta
ttgtgccctttcctagacccccgtttattcacggatatcagagttctccaggacagttgt
tcacactttgtagaaaataatttcaacttaggaatttctagtaagaaggcttttgtatct
tacatgcctcaattccagacttgttctactcagactcgtaagatcatggaaaacaagatg
tgtgacctaactgtataa

DBGET integrated database retrieval system