KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100408221
Entry
100408221         CDS       T03264                                 
Symbol
HSPB1
Name
(RefSeq) heat shock protein family B (small) member 1
  KO
K04455  heat shock protein beta-1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04010  MAPK signaling pathway
cjc04370  VEGF signaling pathway
cjc05146  Amoebiasis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100408221 (HSPB1)
   04370 VEGF signaling pathway
    100408221 (HSPB1)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100408221 (HSPB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cjc03041]
    100408221 (HSPB1)
   03110 Chaperones and folding catalysts [BR:cjc03110]
    100408221 (HSPB1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100408221 (HSPB1)
Spliceosome [BR:cjc03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6.U5 tri-snRNP related factors
    100408221 (HSPB1)
 Complex C
   U4/U6.U5 tri-SnRNP related factors
    100408221 (HSPB1)
Chaperones and folding catalysts [BR:cjc03110]
 Heat shock proteins
  HSP20
   100408221 (HSPB1)
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100408221 (HSPB1)
  Exosomal proteins of breast cancer cells
   100408221 (HSPB1)
  Exosomal proteins of bladder cancer cells
   100408221 (HSPB1)
SSDB
Motif
Pfam: HSP20 YabP
Other DBs
NCBI-GeneID: 100408221
NCBI-ProteinID: XP_002743995
Ensembl: ENSCJAG00000016303
UniProt: F7I2I3
Position
2:9236290..9238023
AA seq 205 aa
MTERRVPFSLLRSPSWDPFRDWYPHNRLFDQAFGMPRLPEEWSQWFGTSSWPGYVRPLPP
AAVEGPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPEELTVKTKDGVVEI
TGKHEERQDEHGFISRCFTRKYSLPPGVDPTQVSSSLSPEGTLTVEAPMPKPATQSNEIT
IPVTFESRAQLGGPEAAKSDQSAAK
NT seq 618 nt   +upstreamnt  +downstreamnt
atgaccgagcgccgcgtccccttctcgctcctgcggagccccagctgggaccccttccgc
gactggtacccgcacaaccgtctcttcgaccaggcattcgggatgccccggctgcccgag
gagtggtcgcagtggttcggcaccagcagctggccgggctacgtgcgccccctgcccccc
gccgcggtcgagggccccgcagtggccgcgcccgcctacagccgcgcgctcagccggcag
ctcagcagcggggtctcggagatccggcacacggcggaccgctggcgcgtgtccctggac
gtcaaccacttcgcccccgaggagctgacggtcaagaccaaggatggcgtggtggagatc
accggcaagcacgaggagcggcaggatgagcacggattcatctcccgctgcttcacccgg
aaatactcgctgccccctggtgtggaccccacccaggtctcctcctccctgtcccctgag
ggcacactgaccgttgaggcccccatgcccaagccagccacacagtccaacgagatcacc
atccctgtcaccttcgagtcgcgggcccagcttgggggcccagaagctgcgaaatctgac
cagtctgcagccaagtaa

DBGET integrated database retrieval system