KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100408304Help
Entry
100408304         CDS       T03264                                 

Gene name
CDK4
Definition
(RefSeq) cyclin dependent kinase 4
  KO
K02089  cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01522  Endocrine resistance
cjc04110  Cell cycle
cjc04115  p53 signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc04218  Cellular senescence
cjc04530  Tight junction
cjc04660  T cell receptor signaling pathway
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc04934  Cushing syndrome
cjc05160  Hepatitis C
cjc05162  Measles
cjc05163  Human cytomegalovirus infection
cjc05164  Influenza A
cjc05165  Human papillomavirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05169  Epstein-Barr virus infection
cjc05200  Pathways in cancer
cjc05203  Viral carcinogenesis
cjc05212  Pancreatic cancer
cjc05214  Glioma
cjc05218  Melanoma
cjc05219  Bladder cancer
cjc05220  Chronic myeloid leukemia
cjc05222  Small cell lung cancer
cjc05223  Non-small cell lung cancer
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
Module
cjc_M00692  Cell cycle - G1/S transition
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100408304 (CDK4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100408304 (CDK4)
   04115 p53 signaling pathway
    100408304 (CDK4)
   04218 Cellular senescence
    100408304 (CDK4)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100408304 (CDK4)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100408304 (CDK4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100408304 (CDK4)
   05203 Viral carcinogenesis
    100408304 (CDK4)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100408304 (CDK4)
   05225 Hepatocellular carcinoma
    100408304 (CDK4)
   05214 Glioma
    100408304 (CDK4)
   05220 Chronic myeloid leukemia
    100408304 (CDK4)
   05218 Melanoma
    100408304 (CDK4)
   05219 Bladder cancer
    100408304 (CDK4)
   05224 Breast cancer
    100408304 (CDK4)
   05222 Small cell lung cancer
    100408304 (CDK4)
   05223 Non-small cell lung cancer
    100408304 (CDK4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100408304 (CDK4)
   04934 Cushing syndrome
    100408304 (CDK4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100408304 (CDK4)
   05162 Measles
    100408304 (CDK4)
   05164 Influenza A
    100408304 (CDK4)
   05160 Hepatitis C
    100408304 (CDK4)
   05163 Human cytomegalovirus infection
    100408304 (CDK4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100408304 (CDK4)
   05169 Epstein-Barr virus infection
    100408304 (CDK4)
   05165 Human papillomavirus infection
    100408304 (CDK4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100408304 (CDK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100408304 (CDK4)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     100408304 (CDK4)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: CMGC group
  CDK family
   100408304 (CDK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo Haspin_kinase Kinase-like
Motif
Other DBs
NCBI-GeneID: 100408304
NCBI-ProteinID: XP_002752715
Ensembl: ENSCJAG00000006697
UniProt: F7DPY6
Position
9
AA seq 302 aa AA seqDB search
MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGAGGGLPVSTVREVALLR
RLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLM
RQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYR
APEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRD
VSLPRGAFHPRGPRPVQSVVPEMEELGAHLLLEMLTFNPHKRISAFRALQHSYLHKDEGN
PE
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggctacctctcgatatgagccagtggctgaaattggtgtcggtgcctatgggacagtg
tacaaggcccgtgatccccacagtggccactttgtggccctcaagagtgtgagagtcccc
aatggaggagctggaggaggccttcccgtcagcacagttcgtgaagtggccttactgagg
cgactggaggcttttgagcatcccaacgttgtccggctgatggatgtctgtgccacatcg
cgaactgaccgagagatcaaggtaaccctggtgtttgagcatgtagaccaagatctaagg
acatatctggacaaggcacccccaccaggcttgcctgcagagaccatcaaggatctgatg
cgccagtttctaagaggcctagattttcttcatgccaattgcatcgttcaccgagatctg
aagccagagaacattctggtgacaagtggtggaacagtcaagctggctgactttggcctg
gccagaatctacagctaccagatggcacttacacctgtggtggttacactctggtaccga
gctcccgaagttcttctgcagtccacatatgcaacacctgtggacatgtggagtgttggc
tgtatctttgctgagatgtttcgtcgaaagcctctcttctgtggaaactctgaagctgac
cagttgggcaaaatctttgacctgattgggctgcctccagaggatgactggcctcgagat
gtatctctgccccgtggagcctttcaccccagagggccccgcccagtgcagtcggtggta
cctgagatggaggagttgggagcacatctgctgttggaaatgctgacttttaacccacac
aagcgaatctctgcctttcgagctctgcagcactcttacctacataaggatgaaggtaat
ccggagtga

DBGET integrated database retrieval system