KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100408318Help
Entry
100408318         CDS       T03264                                 

Gene name
PALB2
Definition
(RefSeq) partner and localizer of BRCA2
  KO
K10897  partner and localizer of BRCA2
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc03440  Homologous recombination
cjc03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    100408318 (PALB2)
   03460 Fanconi anemia pathway
    100408318 (PALB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cjc03400]
    100408318 (PALB2)
DNA repair and recombination proteins [BR:cjc03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA complex
     100408318 (PALB2)
   FA (Fanconi anemia) pathway
    Downstream FA components
     100408318 (PALB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PALB2_WD40
Motif
Other DBs
NCBI-GeneID: 100408318
NCBI-ProteinID: XP_002756042
Ensembl: ENSCJAG00000020619
Position
12
AA seq 1182 aa AA seqDB search
MEEPPGKPLSCEEKEKLKEKLAFLKREYSKTLARLQRAQRAEKIMHSIKKTVEEQDCLSQ
QELSPHLNHSEPKNKIPLYNKLHIKTHLDGETAEKTSITLDVGPESSNPGDGPGELPIQR
TDDTQEHFPHRVSDPDSEKKQKLPRRSKKQQKRTFISQERDCVFDADSLRLSGKSLKEQE
EISSKNPTRSPVTEIRTHFLSLQSELLDSPEPITETNGKSLLIPPTAQPEKGVDTLLRTN
LTKTTTVPLQTPSDSRSQHFESIPPKGSSELTTCGQKSIRFTSPVSLEAHGKKVTVSTEN
LVVNKGVSGHLPTSSNLEADISCSTNELTHNNLSANENQNLKEQNQTEKSLKSSSNALDG
RNENLQENDILSQPKSLSLEATSPLSAENHSCTMLEGLLFPAEYYVRTTRSMSNCQRKVA
VEAVIQSHLDVKKKGFKTKNKDASKNLNLSNEETDQSEIRMSDTCTGQPSSRNSQKLFSL
TKVNSPTAPTEDNDLSRKAVAQASGRRNRGKRKSACTPASDHCEPCLPTSSTSVINRAKD
EVTSHKYQNKKAVIRENGKKSRHQKEDSLSWSNSAYLSLDDDAFTAPFHKNRMLNLKQLS
SFLNMTDFQLPDEDFGPLKLEKLKSCSEKLMEPFESEVYGERHLKGRNCIFPEELSPKYM
DAEMEDLEEDIVVLPGKSHPKMPNPQSQCTKKGLSSSILLYTPLNTVVPDDNDRPTADMC
SPPFPILGTTPAFGSQGSYEKACTEVTGRTCCIPRLAHLKDSVCLASDGKQCDSSSSPAK
PHTTLQVSGRQGQPTCDCESVLQGTPPPTESFTFKENQLYGNTCQELHKRSVQQNEVAVL
PASGSINPGNLKLVSKLKNLSGSCSIDVSAMFWERAGCKEPCIITACEDVVSLWKALGAW
QWEKLYTWHFTEVPVLQIVSVPDVYNLVCVALGNLEIREIRALLCSSDDESEKQVLLKSG
NIKAVLGLTKRRLVSSSGTLSDQQVEVMTFAEDGGSKENQFLMPPAETILTFAEVQGMQE
ALLGTTVMNNIVIWNLKTGQLLRKMHIDDSYQASVCHKAYSETGLLFIVLSHPCTKESEF
LESPVFQLIAINPKTTLNVGVMLYCLPQGQAGRFLEGDVKDHCAAAILTSGTIAIWDLLL
GHCTALLPPISDQNWSFVKWSGTHSHLLAGQKDGNIFIYHYS
NT seq 3549 nt NT seq  +upstreamnt  +downstreamnt
atggaagagcctcccgggaagcccctcagctgtgaggagaaggaaaagttaaaggagaaa
ttagcattcttgaaaagagaatacagcaagacactagcccgccttcagcgtgcccaaagg
gctgaaaaaataatgcattctattaagaaaacggtagaagagcaagattgcttgtcccag
caggaactctcaccacacctaaaccattcagaacctaaaaataaaatacctctttataac
aagttacacatcaaaacccatcttgatggagaaactgcagaaaagacatctatcacactt
gatgttgggcctgagtcttctaaccctggagatggcccaggagaattacctatacaaaga
acagatgacacccaagaacatttcccacacagggtcagtgaccctgatagtgagaaaaaa
cagaaactgccaaggagaagtaagaagcagcagaagagaacatttatttcacaggagaga
gactgtgtctttgacgctgattcactcagactgtctgggaaaagcctaaaggaacaggaa
gaaatcagcagcaaaaatcctactagatcaccagtaactgaaataagaactcacttttta
agtcttcagtctgaacttctggattctccagaaccaattacagaaactaatggaaagagt
ttattaattccaccaactgcccaaccagaaaaaggtgttgatacactcctaagaactaat
ttgaccaagacgactacagttcctttacagactccatcagatagtaggagtcagcacttt
gaaagtattcctcctaaaggtagcagtgaacttactacttgtggccaaaaaagcattaga
tttacttcaccggtaagtttggaggcacatggcaaaaaagtaactgtctctacagagaac
ctggttgtaaataaaggtgtaagtggccatctgcccacaagttctaatttagaggcagat
atttcatgttctacaaatgaactcactcacaataacttatcagcaaatgaaaaccaaaac
ttaaaagaacaaaatcaaacagagaaatctttaaaatcttccagcaatgctcttgatggc
agaaatgaaaatcttcaggaaaatgatattctaagtcaacctaagagtcttagcctagaa
gcaacttctcctctttctgcagaaaatcattcttgcacaatgcttgaaggtcttctgttt
cctgcagaatattatgttagaacaacacgaagcatgtccaattgccagaggaaagtagcc
gtggaggctgtcattcagagtcatttggatgtcaaaaagaaagggtttaaaactaaaaat
aaggatgcaagtaaaaatttaaacctttccaatgaggaaactgaccaaagtgaaattagg
atgtctgacacatgcacaggacaaccgagttcaagaaactctcagaaacttttctcgtta
actaaagtcaactctcccactgcgcctactgaagacaatgacttgtctaggaaggcagtt
gcccaggcatctggtagaagaaacagaggaaaaagaaaatcagcctgcaccccagcatca
gatcattgtgaaccatgtttgccaacttccagtacgtcagttattaatagggccaaagat
gaagtcacctcgcacaaatatcagaacaaaaaggcagttattcgagagaacgggaagaaa
agtcgtcatcaaaaagaggactccctttcttggagtaatagtgcttatttatccttggat
gatgatgctttcacagctccattccataagaatagaatgctgaatttaaagcagctatcg
tcttttctcaatatgacagactttcagttgcctgatgaagactttgggcctcttaagctt
gaaaaactgaaatcctgctcagaaaaactaatggagccctttgaatcagaagtgtatgga
gagaggcatcttaaagggagaaattgtattttcccagaggaactgagtcctaaatacatg
gatgcagaaatggaagacttagaagaggacattgttgttctaccaggaaaatcgcatccc
aagatgccaaacccacaaagccagtgtacaaagaagggcctttcttcatccatattactt
tatactcctttaaatacggttgtgcctgatgataatgatagacctactgcagacatgtgt
tcacctcctttccccatcttaggtactactccagcctttggctctcaaggctcctatgaa
aaagcatgcacagaggtcactggacgaacttgctgtataccccgacttgctcatttgaaa
gactcagtctgtcttgccagtgatggtaaacagtgcgacagttcaagcagcccagcaaaa
ccacataccaccctgcaagtgtcaggcaggcaaggacaacctacctgtgactgtgagtct
gtcttgcaaggaacacccccacccactgagtcattcacttttaaagaaaatcagctctat
ggaaacacatgccaggagttgcataaacggtctgtccaacagaatgaagtagcagtgctt
cctgcttctggtagcataaacccaggcaacctaaaattggtttcaaagttaaagaatctt
tcaggttcctgttccatagatgtgagtgccatgttttgggaaagagccggttgtaaagag
ccatgtatcataactgcttgtgaagatgtagtttctctttggaaagctttgggtgcttgg
cagtgggaaaaactttatacctggcacttcacagaggttccagtattacagatagtttca
gtgcctgatgtgtataatctggtatgtgtggctttgggaaatttggaaatcagggagatc
agggcattgctttgttcctctgatgatgaaagtgaaaagcaagtattactgaagtctgga
aatataaaagctgtgcttggcctgacaaagaggaggctagttagtagcagtgggaccctt
tctgatcaacaagttgaagttatgacatttgcagaagatggaggaagcaaagaaaaccaa
tttttgatgccccctgcggagactattctaacttttgctgaggtccaagggatgcaagaa
gctctgcttggtactactgttatgaacaacattgttatttggaatttaaaaactggtcaa
ctcctgagaaagatgcacattgatgattcttaccaagcttcagtctgtcacaaagcctat
tctgaaacagggcttctgtttattgtcctgagtcatccctgtaccaaagagagtgagttt
ttggaaagccctgtgtttcaactgattgcgattaaccctaagacgaccctgaatgtgggt
gtgatgttgtactgtcttcctcaagggcaggctggcaggttcctggaaggtgacgtgaaa
gatcattgtgcagcggcaatcttgacttctggaacaattgccatttgggatttacttctc
ggtcactgcactgccctcctcccacctatctctgaccaaaactggtcttttgtgaaatgg
tcaggtacacactctcatttgttggctggacaaaaagatggaaatatattcatatatcac
tactcataa

DBGET integrated database retrieval system