KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100408515Help
Entry
100408515         CDS       T03264                                 

Gene name
GNAS
Definition
(RefSeq) guanine nucleotide-binding protein G(s) subunit alpha
  KO
K04632  guanine nucleotide-binding protein G(s) subunit alpha
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01522  Endocrine resistance
cjc04015  Rap1 signaling pathway
cjc04020  Calcium signaling pathway
cjc04024  cAMP signaling pathway
cjc04072  Phospholipase D signaling pathway
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04270  Vascular smooth muscle contraction
cjc04540  Gap junction
cjc04611  Platelet activation
cjc04713  Circadian entrainment
cjc04714  Thermogenesis
cjc04724  Glutamatergic synapse
cjc04726  Serotonergic synapse
cjc04728  Dopaminergic synapse
cjc04730  Long-term depression
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04911  Insulin secretion
cjc04912  GnRH signaling pathway
cjc04913  Ovarian steroidogenesis
cjc04915  Estrogen signaling pathway
cjc04916  Melanogenesis
cjc04918  Thyroid hormone synthesis
cjc04921  Oxytocin signaling pathway
cjc04922  Glucagon signaling pathway
cjc04923  Regulation of lipolysis in adipocytes
cjc04924  Renin secretion
cjc04925  Aldosterone synthesis and secretion
cjc04926  Relaxin signaling pathway
cjc04927  Cortisol synthesis and secretion
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc04934  Cushing syndrome
cjc04961  Endocrine and other factor-regulated calcium reabsorption
cjc04962  Vasopressin-regulated water reabsorption
cjc04970  Salivary secretion
cjc04971  Gastric acid secretion
cjc04972  Pancreatic secretion
cjc04976  Bile secretion
cjc05030  Cocaine addiction
cjc05031  Amphetamine addiction
cjc05032  Morphine addiction
cjc05034  Alcoholism
cjc05142  Chagas disease (American trypanosomiasis)
cjc05146  Amoebiasis
cjc05163  Human cytomegalovirus infection
cjc05165  Human papillomavirus infection
cjc05200  Pathways in cancer
cjc05414  Dilated cardiomyopathy (DCM)
Module
cjc_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100408515 (GNAS)
   04020 Calcium signaling pathway
    100408515 (GNAS)
   04072 Phospholipase D signaling pathway
    100408515 (GNAS)
   04024 cAMP signaling pathway
    100408515 (GNAS)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100408515 (GNAS)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100408515 (GNAS)
  09152 Endocrine system
   04911 Insulin secretion
    100408515 (GNAS)
   04922 Glucagon signaling pathway
    100408515 (GNAS)
   04923 Regulation of lipolysis in adipocytes
    100408515 (GNAS)
   04912 GnRH signaling pathway
    100408515 (GNAS)
   04913 Ovarian steroidogenesis
    100408515 (GNAS)
   04915 Estrogen signaling pathway
    100408515 (GNAS)
   04921 Oxytocin signaling pathway
    100408515 (GNAS)
   04926 Relaxin signaling pathway
    100408515 (GNAS)
   04918 Thyroid hormone synthesis
    100408515 (GNAS)
   04928 Parathyroid hormone synthesis, secretion and action
    100408515 (GNAS)
   04916 Melanogenesis
    100408515 (GNAS)
   04924 Renin secretion
    100408515 (GNAS)
   04925 Aldosterone synthesis and secretion
    100408515 (GNAS)
   04927 Cortisol synthesis and secretion
    100408515 (GNAS)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100408515 (GNAS)
   04270 Vascular smooth muscle contraction
    100408515 (GNAS)
  09154 Digestive system
   04970 Salivary secretion
    100408515 (GNAS)
   04971 Gastric acid secretion
    100408515 (GNAS)
   04972 Pancreatic secretion
    100408515 (GNAS)
   04976 Bile secretion
    100408515 (GNAS)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100408515 (GNAS)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100408515 (GNAS)
  09156 Nervous system
   04724 Glutamatergic synapse
    100408515 (GNAS)
   04728 Dopaminergic synapse
    100408515 (GNAS)
   04726 Serotonergic synapse
    100408515 (GNAS)
   04730 Long-term depression
    100408515 (GNAS)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100408515 (GNAS)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100408515 (GNAS)
   04714 Thermogenesis
    100408515 (GNAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100408515 (GNAS)
  09165 Substance dependence
   05030 Cocaine addiction
    100408515 (GNAS)
   05031 Amphetamine addiction
    100408515 (GNAS)
   05032 Morphine addiction
    100408515 (GNAS)
   05034 Alcoholism
    100408515 (GNAS)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    100408515 (GNAS)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100408515 (GNAS)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100408515 (GNAS)
   05165 Human papillomavirus infection
    100408515 (GNAS)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100408515 (GNAS)
   05142 Chagas disease (American trypanosomiasis)
    100408515 (GNAS)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100408515 (GNAS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100408515 (GNAS)
   04031 GTP-binding proteins [BR:cjc04031]
    100408515 (GNAS)
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100408515 (GNAS)
  Exosomal proteins of other body fluids (saliva and urine)
   100408515 (GNAS)
  Exosomal proteins of colorectal cancer cells
   100408515 (GNAS)
  Exosomal proteins of bladder cancer cells
   100408515 (GNAS)
GTP-binding proteins [BR:cjc04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 2 (Gs)
    100408515 (GNAS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc
Motif
Other DBs
NCBI-GeneID: 100408515
NCBI-ProteinID: XP_002747764
Ensembl: ENSCJAG00000018939
Position
5
AA seq 1046 aa AA seqDB search
MGVRNCLDGNNMSGQHDISPEIGEQPEQPPLEAPGAAAPGAGPSPAEEMETEPPYSEPIP
LENDGEACGTPVVSRPNFQVLSPPFKEAGAHGSYSPPPEEAMPFEVEQPSLGGFWPTLEQ
PGSPSGAQTGLEAFGSALMEPGAFGGGRPGVGGYSPPPEEAMPFEFDQPAQRGCSQPLLQ
VPDLAPGGPGAAGVPRAPPEEPQALKPPKAGSGGGYSPPPEETMPFELDGEGFGEDSPPP
GLSRVIAQVDDGGGQFAAVAVSSAVRLTPAANAPPLWVPGTIGSPSREAVRPPNFTSSSP
PMEISGPPLEIGSAPAGVDDAPVNMDSPPIALDGPPIKVSGAPDKRERAERPPVEEEAAE
MEGGTATDATEGGKVPSPGDRSPAAGAASADPAARAAPAAPADPDSRAAPADPDSGTAPG
SPDSREAPADPDSGTAPADPDSGAAPADPDSGAAPDAPADPDAGAAPDAPADPDSRAAPD
APGAPAAAETGAAPVAPAAPDAGAPAAPAAPAARAAPAARAASAAPASGARRKLHLLRPP
SPEIQAADPPTPRPTRASAWRGKSERSRGRHGYYDEGAASSDDDSSGDESDDGTFGCIRW
FQHRRNRRRRKPRRNLLRNFLMQAFGGCFGRSESPQPKASRSPKVKKVPLAEKRRQMRKE
ALEKRAQKRAEKKRSKLIDKQLQDEKMGYMCTHRLLLLGAGESGKSTIVKQMRILHVNGF
NGEGGEEDPQAARSNSDGEKATKVQDIKNNLKEAIETIVAAMSNLVPPVELANPENQFRV
DYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQLIDCAQYFLDKIDVIKQA
DYVPSDQDLLRCRVLTSGIFETKFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVV
ASSSYNMVIREDNQTNRLQEALNLFKSIWNNRWLRTISVILFLNKQDLLAEKVLAGKSKI
EDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYCYPHFTCAVD
TENIRRVFNDCRDIIQRMHLRQYELL
NT seq 3141 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtgcgcaactgcctcgacggcaataatatgtcaggacaacacgatatctcccct
gaaatcggggaacagcccgagcaaccacctttggaggccccaggggcagctgcccccggt
gctgggcctagcccagccgaagagatggagaccgaaccgccttacagcgagcccatcccc
ctcgagaatgacggcgaggcctgtggaaccccagtggtctccaggcccaactttcaggtt
ctcagtccgcccttcaaggaagctggagcccatggaagctacagcccacctcccgaggaa
gccatgcccttcgaggtcgaacagcccagcttgggaggcttctggcccacactggagcag
cctggatcccccagtggggcccagacaggccttgaggccttcggctcagcactcatggag
cctggagccttcggtggtggcagaccaggtgtgggaggatacagccctccaccagaagaa
gctatgccctttgaatttgaccagcctgcccagagaggctgcagtcaacctctcttacag
gtcccagaccttgctccaggaggcccaggtgctgcaggggtccccagagctcctcccgag
gagccccaagccctcaagcctccaaaggctggctccggaggaggctatagccctccccct
gaggagactatgccatttgagcttgatggagaaggctttggggaagacagcccacccccg
gggctttcccgagtcatcgcacaagtcgacgacggcggtggccagtttgcggcagtcgcg
gtctcgagtgcggtccgcctcactcccgccgcgaatgcgcctcccctctgggtcccagga
accatcggcagcccatcccgagaggctgtcagacctcctaacttcaccagcagcagcccc
ccgatggagatctccggacccccacttgagattggcagcgcccccgctggggtcgacgac
gctcccgtcaacatggacagccccccaatcgcgcttgacggcccgcccatcaaggtctcc
ggagccccagataagagagagcgagcagagagacccccagttgaggaggaagcagccgag
atggaaggaggcacagccaccgatgccacggagggaggaaaagtcccctctccgggggac
agatcccctgccgccggggcagcctcagcggatcccgcagccagggcggcccctgcagcc
ccagccgatcccgactcccgggcagccccagccgatcccgactccgggacagccccaggc
agtcccgactcccgggaagccccagccgatcccgactccgggacagccccagccgatccc
gactctggggcagccccagccgatcccgactctggggcagcccctgacgccccagccgat
ccagatgccggggcagcccctgacgccccagccgatcctgactcccgggcagcccctgac
gctcccggcgcccctgcggctgctgagaccggggcagcccctgtcgccccagctgcgcct
gacgctggggccccagctgccccagccgctcctgccgcccgggcagccccagcagcccgg
gcagcctctgcagcccctgcctccggggccagacgcaagctccatctccttagacccccc
agccccgaaatccaggctgccgatccgcctactccacggcctactcgcgcgtctgcctgg
cggggcaagtccgagcgcagccgcggccgccacgggtactacgatgaaggggcggccagc
agcgacgatgactccagcggagacgagtccgacgatgggaccttcggatgcatccgctgg
tttcagcatcggcgaaaccgccgccgccgaaagccccggcgcaacttactccgcaacttc
ctcatgcaagccttcgggggctgcttcggtcgatctgagagtccccagcccaaagcttca
cgctcccccaaggtcaagaaggtacccctggcggagaaacgcagacagatgcgcaaagaa
gccctggagaagcgggcccagaagcgtgcagagaagaaacgcagcaagctcatcgacaag
caactccaggacgaaaagatgggctacatgtgtacgcaccgcctgctgcttctaggtgct
ggagaatctggtaaaagcaccattgtgaagcagatgaggatcctgcatgttaatgggttt
aatggagagggcggcgaagaggacccgcaggctgcaaggagcaacagcgatggtgagaag
gcaaccaaagtgcaggacatcaaaaacaacctgaaagaggcaatcgaaaccattgtggcc
gccatgagcaacctggtaccccctgtggagctggccaaccctgagaaccagttcagagtg
gactacattctgagtgtgatgaacgtgcctgacttcgacttccctcctgaattctatgag
catgccaaggctctgtgggaggatgaaggagtgcgtgcctgctacgaacgctccaacgag
taccagctgattgactgtgcccagtacttcctggacaagatcgatgtgatcaagcaggcc
gactatgtgccgagcgaccaggacctgcttcgctgccgcgtcctgacttctggaatcttt
gagaccaagttccaggtggacaaagtcaacttccacatgtttgatgtgggtggccagcgt
gacgagcgccgcaagtggatccagtgcttcaacgatgtgactgccatcatcttcgtggtg
gccagcagcagctacaacatggtcatccgggaggacaaccagaccaaccgcctgcaggag
gctctgaacctcttcaagagcatctggaacaacagatggctgcgtaccatctctgtgatc
ctgttcctcaacaagcaagatctgctcgctgagaaagtccttgctgggaaatcgaagatt
gaggactactttccagaattcgctcgctacactactcctgaggatgctactcccgagccc
ggagaggacccacgcgtgacccgggccaagtacttcattcgagatgagtttctgaggatc
agcactgccagtggggatgggcgccactactgctaccctcacttcacctgcgctgtggac
actgagaacatccgccgtgtgttcaacgactgccgtgacatcatccagcgcatgcacctt
cgccagtacgagctgctctaa

DBGET integrated database retrieval system