KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100408604Help
Entry
100408604         CDS       T03264                                 

Gene name
CXCL13
Definition
(RefSeq) C-X-C motif chemokine ligand 13
  KO
K10032  C-X-C motif chemokine 13
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04061  Viral protein interaction with cytokine and cytokine receptor
cjc04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100408604 (CXCL13)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100408604 (CXCL13)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100408604 (CXCL13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100408604 (CXCL13)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Chemokines
   100408604 (CXCL13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8 Herpes_UL1
Motif
Other DBs
NCBI-GeneID: 100408604
NCBI-ProteinID: XP_002745752
Ensembl: ENSCJAG00000014839
Position
3
AA seq 104 aa AA seqDB search
MNFILASLLLMLLISSLSPVQGILEVHNTNLRCKCVQETSAFIPLTLIDRIQILPRGHGC
PRKEIIIWKKNKSVVCLNPRAEWIQKIMKNLKKKKDSNSTTSSV
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgaatttcatcttggcatctctgcttctcatgctgctgatcagcagcctttccccagtt
caaggtattctggaggtccataacacaaacttgaggtgtaaatgtgtccaagagacctca
gcctttatccccctaaccctcattgatcgaattcaaatcttgccccgtgggcatggttgt
ccaaggaaagaaatcataatctggaagaagaacaagtcagttgtgtgcctgaaccctcga
gctgaatggatacaaaaaataatgaaaaacttgaaaaaaaaaaaggattccaactctacc
acttccagtgtttaa

DBGET integrated database retrieval system