KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100408692Help
Entry
100408692         CDS       T03264                                 

Gene name
DDX58
Definition
(RefSeq) DExD/H-box helicase 58
  KO
K12646  ATP-dependent RNA helicase DDX58 [EC:3.6.4.13]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04064  NF-kappa B signaling pathway
cjc04622  RIG-I-like receptor signaling pathway
cjc04623  Cytosolic DNA-sensing pathway
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05162  Measles
cjc05164  Influenza A
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100408692 (DDX58)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    100408692 (DDX58)
   04623 Cytosolic DNA-sensing pathway
    100408692 (DDX58)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    100408692 (DDX58)
   05164 Influenza A
    100408692 (DDX58)
   05161 Hepatitis B
    100408692 (DDX58)
   05160 Hepatitis C
    100408692 (DDX58)
   05168 Herpes simplex virus 1 infection
    100408692 (DDX58)
   05169 Epstein-Barr virus infection
    100408692 (DDX58)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:cjc04054]
    100408692 (DDX58)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     100408692 (DDX58)
Pattern recognition receptors [BR:cjc04054]
 Cytoplasmic pattern recognition receptors
  RIG-I-like receptors
   100408692 (DDX58)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CARD_2 RIG-I_C RIG-I_C-RD DEAD ResIII Helicase_C AAA_22 AAA_25 Syntaxin_2
Motif
Other DBs
NCBI-GeneID: 100408692
NCBI-ProteinID: XP_002743043
Ensembl: ENSCJAG00000007741
UniProt: F7IL46
Position
1
AA seq 925 aa AA seqDB search
MTVEQRSSLRAFRDYIRKTLDPTYIMSYMAPWLREEEMQYIQAEKNNKGPVEAATLFLKI
LLELQEEGWFRGFLDALDHAGYSGLYEAIESWDFQKIEKLEEYRLLLKRLQPEFKSRIIP
TDILPDLSECLINQECEEIIQICSTKGMMAGAEKLVECLLRSDKENWPKTLKLALEKDRN
KFSELWIVEKGIKDVETEDLEEKLETSDIQIFYQEDPECQNLSENSCLPSEVSDTNLYSP
FKPRSYQLELALPAKKGKNTIICAPTGCGKTLVALLICEHHLKKFPQGQKGKVVFFANQI
PVYEQQKSVFSKYFERLGYRVTGISGATAENVPVKQIVENNDIIILTPQILVNNLKNGTI
PSLSIFTLMIFDECHNTSKQHPYNMIMFNYLDQKLGGSSGPLPQVIGLTASVGVGDAKNT
DEALDYICKLCASLDASVIATVQDNLKELEQVVYKPQKFFRKVESRISDKFKCIIAQLMR
ETEGLAKRICKDLENLSQIQNREFGTQKYEQWIVTVQKACMVFQMPDKDEESRICKALFL
YTSHLRKYNDALIISEHARMKDALHYLKDFFSNVRAAGFDETEQDLTQRFEEKLQELESI
SRDPSNENPKLEDLCFILREEYHLNPETITILFVKTRALVDALKNWIEGNSKLSFLKPGI
LTGRSKTNQNTGMTLPAQKCILDSFKAHGDHNILIATSVADEGIDIAQCNLVILYEYVGN
VIKMIQTRGRGRARGSKCFLLTSNAAVIEKENINMYKEKMMNDSILRLQTWDEEVFKEKI
LHIQIHEKFIRDSQEKPKPVPDKENKKLLCRKCKAFACYTADIRVIEESQFTVLGDAFKE
CFVSRPHPKPKQFSNFYKRAKIFCARQDCSHDWGIHVKYKTFEIPVIKIESFVVEDIATG
VQTLYSKWKDFHFEKIPFDAAEMSK
NT seq 2778 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcgagcagcggagcagcctgcgagccttccgcgattatatccggaagaccctg
gaccctacctacatcatgagctacatggccccctggcttagggaggaagagatgcagtac
attcaggctgagaaaaacaacaagggtccagtggaggctgccacactttttctcaagatc
ctgttggagctccaggaggaaggctggttccgtggctttttggatgccctagaccatgca
ggttattctggactttatgaagccattgaaagttgggatttccaaaaaattgaaaagttg
gaggagtatagattacttttaaaacgtttacaaccagaatttaaaagtagaattattcca
acagatatccttcctgatctatctgaatgtttaattaatcaggagtgtgaagaaattata
cagatttgctccactaagggaatgatggcaggtgcagagaaattggtggaatgccttctc
agatcagataaagagaactggcccaaaactttgaaacttgctttggagaaagataggaac
aagttcagtgagctgtggattgtagagaaaggtataaaagatgtggaaacggaagatctt
gaggagaagttggaaacttctgacatacagattttctaccaagaagatccagaatgccag
aacctgagtgagaattcatgtctgccttcagaagtgtctgatacaaacttgtacagccca
tttaaaccaagaagttaccaattagagcttgctttgcctgccaagaaaggaaaaaacaca
ataatatgtgctcctacaggttgtggaaaaaccttagttgcactccttatatgtgaacat
catcttaaaaaattcccgcaaggacaaaaggggaaagttgtctttttcgctaatcagatc
ccagtgtatgaacagcagaaatctgtattctcaaaatactttgaaagacttgggtataga
gttacaggcatttctggagcaacagctgagaatgtcccagtgaaacagattgttgagaac
aacgacatcatcattttaactccacagattcttgtgaacaaccttaaaaatggaacgatt
ccatcactgtccatctttactttgatgatatttgatgaatgccacaacactagtaaacaa
catccatacaatatgatcatgttcaattatctagatcagaaacttggaggatcttcaggc
ccactgccccaggtcattgggctgactgcctcggttggtgttggggatgccaaaaacaca
gatgaagctttggattatatctgcaaactctgtgcttctcttgatgcgtcagtgatagca
acagtccaagacaacctgaaggaactggagcaagttgtttataagccccagaagtttttc
aggaaagtggaatcacggattagcgacaaatttaaatgcatcatagctcagctgatgaga
gagacagagggtctggcaaagagaatctgcaaagaccttgaaaacttatctcaaattcaa
aatagggaatttggaacacaaaaatatgaacaatggattgttacagttcagaaagcatgc
atggtgttccagatgccagacaaagatgaagagagcaggatttgtaaagccctgtttttg
tacacttcacatttgcggaaatataatgatgccctcattatcagtgagcatgcacgaatg
aaggatgctctgcattacttgaaagacttcttcagcaatgtccgggcagcaggattcgat
gagactgagcaagatcttactcagagatttgaagaaaagctgcaggaactagaaagtatt
tccagggatcccagcaatgagaaccctaaacttgaagacctctgcttcatcttaagagaa
gagtaccacttaaacccagagacaataacaattctctttgtgaaaaccagagcacttgtg
gatgctttaaaaaattggattgaaggaaattctaaactcagttttctaaaacctggcata
ttgactggacgtagcaaaacaaatcagaacacaggaatgactctcccagcgcagaagtgt
atattggattcatttaaagcccacggagatcacaatattctgattgccacctcagttgct
gatgaaggcattgacattgctcagtgcaatcttgtcatcctgtatgagtatgtgggtaat
gtcatcaaaatgatccaaaccagaggcagaggaagagcaagaggtagcaagtgcttcctt
ctgactagtaatgctgctgtaattgaaaaagagaacataaacatgtacaaagaaaaaatg
atgaatgactccattttacgccttcagacgtgggatgaagaagtatttaaggaaaagatt
ctgcatatacagattcatgaaaaattcatcagagatagtcaagaaaaaccaaaacctgta
cctgataaggaaaataaaaaactgctttgcagaaagtgcaaagccttcgcatgttacaca
gctgacataagagtgatagaggaatcccaattcactgtgcttggagatgcttttaaggaa
tgctttgtgagtagaccacatcctaaaccaaagcagttttcaaatttttataaaagagca
aagatattctgtgcccgacaggactgcagccatgactggggaatccatgtgaagtacaag
acatttgagattccagttataaaaattgaaagttttgtggtggaggatattgcaactgga
gttcagacactgtactcaaagtggaaggactttcattttgagaagataccatttgatgca
gcagaaatgtccaaatga

DBGET integrated database retrieval system