KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100408947Help
Entry
100408947         CDS       T03264                                 

Gene name
BCL2
Definition
(RefSeq) BCL2, apoptosis regulator
  KO
K02161  apoptosis regulator Bcl-2
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01521  EGFR tyrosine kinase inhibitor resistance
cjc01522  Endocrine resistance
cjc01524  Platinum drug resistance
cjc04064  NF-kappa B signaling pathway
cjc04066  HIF-1 signaling pathway
cjc04071  Sphingolipid signaling pathway
cjc04115  p53 signaling pathway
cjc04140  Autophagy - animal
cjc04141  Protein processing in endoplasmic reticulum
cjc04151  PI3K-Akt signaling pathway
cjc04210  Apoptosis
cjc04215  Apoptosis - multiple species
cjc04217  Necroptosis
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04340  Hedgehog signaling pathway
cjc04510  Focal adhesion
cjc04621  NOD-like receptor signaling pathway
cjc04630  Jak-STAT signaling pathway
cjc04722  Neurotrophin signaling pathway
cjc04725  Cholinergic synapse
cjc04915  Estrogen signaling pathway
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc05014  Amyotrophic lateral sclerosis (ALS)
cjc05145  Toxoplasmosis
cjc05152  Tuberculosis
cjc05161  Hepatitis B
cjc05162  Measles
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05200  Pathways in cancer
cjc05206  MicroRNAs in cancer
cjc05210  Colorectal cancer
cjc05215  Prostate cancer
cjc05222  Small cell lung cancer
cjc05226  Gastric cancer
cjc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100408947 (BCL2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    100408947 (BCL2)
   04630 Jak-STAT signaling pathway
    100408947 (BCL2)
   04064 NF-kappa B signaling pathway
    100408947 (BCL2)
   04066 HIF-1 signaling pathway
    100408947 (BCL2)
   04071 Sphingolipid signaling pathway
    100408947 (BCL2)
   04151 PI3K-Akt signaling pathway
    100408947 (BCL2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100408947 (BCL2)
  09143 Cell growth and death
   04210 Apoptosis
    100408947 (BCL2)
   04215 Apoptosis - multiple species
    100408947 (BCL2)
   04217 Necroptosis
    100408947 (BCL2)
   04115 p53 signaling pathway
    100408947 (BCL2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100408947 (BCL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100408947 (BCL2)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100408947 (BCL2)
   04928 Parathyroid hormone synthesis, secretion and action
    100408947 (BCL2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100408947 (BCL2)
  09156 Nervous system
   04725 Cholinergic synapse
    100408947 (BCL2)
   04722 Neurotrophin signaling pathway
    100408947 (BCL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100408947 (BCL2)
   05206 MicroRNAs in cancer
    100408947 (BCL2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100408947 (BCL2)
   05226 Gastric cancer
    100408947 (BCL2)
   05215 Prostate cancer
    100408947 (BCL2)
   05222 Small cell lung cancer
    100408947 (BCL2)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    100408947 (BCL2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100408947 (BCL2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100408947 (BCL2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100408947 (BCL2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100408947 (BCL2)
   05162 Measles
    100408947 (BCL2)
   05161 Hepatitis B
    100408947 (BCL2)
   05168 Herpes simplex virus 1 infection
    100408947 (BCL2)
   05169 Epstein-Barr virus infection
    100408947 (BCL2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100408947 (BCL2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100408947 (BCL2)
   01524 Platinum drug resistance
    100408947 (BCL2)
   01522 Endocrine resistance
    100408947 (BCL2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cjc01009]
    100408947 (BCL2)
Protein phosphatases and associated proteins [BR:cjc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100408947 (BCL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Bcl-2 Bcl-2_3
Motif
Other DBs
NCBI-GeneID: 100408947
NCBI-ProteinID: XP_017819098
Position
13
AA seq 217 aa AA seqDB search
MVHAVITCDYTREIVMRYIYYNLASSLPSPGTRPVPPLPRDPVARTSPPPPPAAPAAAAT
GPTLSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGV
NWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELY
GPSMRPLFDFSWLSLKTLLSLVLVGACITLGAYLGHK
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggtgcacgctgtgataacatgtgactatacccgggaaatagtgatgagatacatctac
tataatctggcatcttctcttcccagcccgggcacacgcccggtcccgccgcttccccgg
gacccggtcgccaggacctcgccgccgccgcccccagccgcccccgccgccgccgccacg
gggcctacgctcagcccggtgccacctgtggtccacctgaccctccgccaggccggcgac
gacttctcccgccgctaccgccgcgacttcgccgagatgtccagccagctgcacctgacg
cccttcaccgcgcggggacgctttgccacggtggtggaggagctcttcagggacggggtg
aactgggggaggattgtggccttctttgagttcggtggggtcatgtgtgtggagagcgtc
aaccgggagatgtcgcccctggtggacaacatcgccctgtggatgaccgagtacctgaac
cggcacctgcacacctggatccaggataacggaggctgggatgcctttgtggaactgtat
ggccccagcatgcggcctctgtttgatttctcctggctgtctctgaagactctgctcagc
ttggtcctggtgggagcttgcatcaccctgggtgcctatctgggccacaagtga

DBGET integrated database retrieval system