KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100409009Help
Entry
100409009         CDS       T03264                                 

Gene name
CNP
Definition
(RefSeq) 2',3'-cyclic nucleotide 3' phosphodiesterase
  KO
K01121  2',3'-cyclic-nucleotide 3'-phosphodiesterase [EC:3.1.4.37]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100409009 (CNP)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.37  2',3'-cyclic-nucleotide 3'-phosphodiesterase
     100409009 (CNP)
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of oligodendrocytes
   100409009 (CNP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CNPase AAA_33 6PF2K AAA_22 Zeta_toxin KTI12 AAA_16 AAA AAA_17 ABC_tran AAA_30 NACHT AAA_18 DUF4823 NB-ARC
Motif
Other DBs
NCBI-GeneID: 100409009
NCBI-ProteinID: XP_017828218
Position
5
AA seq 401 aa AA seqDB search
MSSSGAKDKPELQFPFLQDEDTVATLQECKTLFILRGLPGSGKSTLARVIVDKYRDGTKM
VSADAYKITPGARGAFSEEYKRLDEDLAAYCRRRDIRILVLDDTNHERERLEQLFEMADQ
YQYQVVLVEPKTAWRLDCAQLKEKNQWQLSADDLKKLKPGLEKDFLPLYFGWFLTKKSSE
ILRKVGQVFQEELGNHKAFKKESRHFFSGDETREKIDLVTYFGKRPPGVLHCTTKFCDYG
KAPGAEEYAQQDVLKKSYCKXFTLTISALFVTPXTTGARVELSEQQLQLWPNDVDKLLPT
DNLPRGSRAHITLGCAADVEAVQTGLDLLEIVREEKGGSRGEEVGELSRGKLYSLGKGRW
MLNLAKNMEVRAIFTGYYGKGKPVPTQGSRKGGALQSCTII
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcctcaggggccaaggacaagcctgagctgcagtttcccttccttcaggatgag
gacacggtggccacgctgcaagagtgcaagacgctcttcatcttgcgcggcctgccagga
agcggcaagtccacgctggcacgggtcatcgtagacaagtaccgtgatggcaccaagatg
gtgtcggctgatgcttacaagatcacccccggcgctcgaggagccttctccgaggagtac
aagcggctggatgaggacctggctgcctactgccgccgccgggacatcagaattcttgtg
ctagatgacaccaaccacgagcgggaacggctggagcagctctttgaaatggccgaccag
taccagtaccaggtggtgctggtggagcccaagacagcgtggcggctggactgtgcccag
ctcaaggagaagaaccagtggcagctgtcggctgatgacctgaagaagctgaagcctggg
ctggagaaggacttcctgccgctctacttcggctggttcctgaccaagaagagctccgag
atactccgaaaagtgggccaggtcttccaggaagagctggggaaccacaaggccttcaag
aaggagtcgcgacactttttctctggggatgagaccagggagaagattgatctggtcacc
tactttgggaagagacccccaggtgtgctgcactgcacaaccaagttttgtgactacggg
aaggcccccggggcagaggagtacgctcaacaagatgtgttaaagaaatcttactgcaag
ngcttcacactgaccatctctgccctctttgtgacaccanagacaactggggcccgagtg
gagttgagcgagcagcagctgcagttgtggccgaatgatgtggacaagctgttgcccact
gacaacctgccgcggggaagccgtgctcacatcacccttggctgtgccgctgacgtggag
gctgtgcagacaggccttgacctcttagagattgtacgggaggagaagggaggcagccga
ggcgaggaggtgggtgagctaagccggggcaagctctactccttgggcaaggggcgctgg
atgttgaacctggccaagaacatggaagtcagggccatcttcacgggatactatgggaaa
ggcaaacccgtgcccacacagggcagccggaaggggggtgccttgcagtcctgcaccatc
atatga

DBGET integrated database retrieval system