KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100409028Help
Entry
100409028         CDS       T03264                                 

Gene name
CASP9
Definition
(RefSeq) caspase 9
  KO
K04399  caspase 9 [EC:3.4.22.62]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01524  Platinum drug resistance
cjc04115  p53 signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc04210  Apoptosis
cjc04215  Apoptosis - multiple species
cjc04370  VEGF signaling pathway
cjc04919  Thyroid hormone signaling pathway
cjc05010  Alzheimer disease
cjc05012  Parkinson disease
cjc05014  Amyotrophic lateral sclerosis (ALS)
cjc05016  Huntington disease
cjc05134  Legionellosis
cjc05145  Toxoplasmosis
cjc05152  Tuberculosis
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05162  Measles
cjc05163  Human cytomegalovirus infection
cjc05164  Influenza A
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05200  Pathways in cancer
cjc05210  Colorectal cancer
cjc05212  Pancreatic cancer
cjc05213  Endometrial cancer
cjc05215  Prostate cancer
cjc05222  Small cell lung cancer
cjc05223  Non-small cell lung cancer
cjc05416  Viral myocarditis
Module
cjc_M00685  Apoptotic machinery
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    100409028 (CASP9)
   04151 PI3K-Akt signaling pathway
    100409028 (CASP9)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100409028 (CASP9)
   04215 Apoptosis - multiple species
    100409028 (CASP9)
   04115 p53 signaling pathway
    100409028 (CASP9)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100409028 (CASP9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100409028 (CASP9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100409028 (CASP9)
   05212 Pancreatic cancer
    100409028 (CASP9)
   05215 Prostate cancer
    100409028 (CASP9)
   05213 Endometrial cancer
    100409028 (CASP9)
   05222 Small cell lung cancer
    100409028 (CASP9)
   05223 Non-small cell lung cancer
    100409028 (CASP9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100409028 (CASP9)
   05012 Parkinson disease
    100409028 (CASP9)
   05014 Amyotrophic lateral sclerosis (ALS)
    100409028 (CASP9)
   05016 Huntington disease
    100409028 (CASP9)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100409028 (CASP9)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    100409028 (CASP9)
   05152 Tuberculosis
    100409028 (CASP9)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100409028 (CASP9)
   05162 Measles
    100409028 (CASP9)
   05164 Influenza A
    100409028 (CASP9)
   05161 Hepatitis B
    100409028 (CASP9)
   05160 Hepatitis C
    100409028 (CASP9)
   05168 Herpes simplex virus 1 infection
    100409028 (CASP9)
   05163 Human cytomegalovirus infection
    100409028 (CASP9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100409028 (CASP9)
   05169 Epstein-Barr virus infection
    100409028 (CASP9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100409028 (CASP9)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100409028 (CASP9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cjc01009]
    100409028 (CASP9)
   01002 Peptidases [BR:cjc01002]
    100409028 (CASP9)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.62  caspase-9
     100409028 (CASP9)
Protein phosphatases and associated proteins [BR:cjc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100409028 (CASP9)
Peptidases [BR:cjc01002]
 Cysteine Peptidases
  Family C14: caspase family
   100409028 (CASP9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C14 CARD CARD_2
Motif
Other DBs
NCBI-GeneID: 100409028
NCBI-ProteinID: XP_008998705
Ensembl: ENSCJAG00000008732
Position
7
AA seq 419 aa AA seqDB search
MKEADRLLLQRHRRLLVKELRVDQLWDALLSRELFKPHMIEDIQRAGCGSRRDQARQLIT
DLESRGSQALPLFISCLEETGQYTLASILQTNRQTEKFLIPKPKDHRPVDFDSGGLGDGG
APENLRGNADLAYVMSTEPCGHCLIINNVNFSFESRLSIRTGSDIDCGKLQLRFSLLHFM
VEVKRDLTAKEMRLTLLELARRDHGALDCCVVVILSHGCQASHLQFPGAVYGTDGYPVSV
EKIVNIFNGTSCPSLGGKPKLFFIQACGGEQKDHGFEVASTSPQEESPGSNPESDATPFQ
EDAWTFDQVDAVSSLPTPSDIFVSYSTFPGFVSWRERKNGSWYVETLDDIFEQWAHCEDL
QSCCSGSLMLFRRKGFINRCLVSLISSGKNFFLKHHKARVLHPALSCTPKPSCLRPESG
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaagcggaccggctgcttctgcagcggcaccggcggctgctggtgaaggagctg
cgggtggaccagctctgggacgccttgctgagccgcgagctgttcaagccccacatgatc
gaggacatccagcgggcaggctgtggatctcggcgagatcaggccaggcagctgatcaca
gatctagagtctcgagggagtcaagcccttcctttgttcatctcctgcttagaggagaca
ggccagtacacattggcttcgatcctgcaaactaataggcaaacagaaaagttcttgatt
cccaaaccaaaggatcacagaccagtggactttgattctggaggattgggtgatggcggt
gcccctgagaatttgaggggaaatgcggatttggcttatgtcatgagcacggagccctgt
ggccactgcctcattatcaacaatgtgaacttcagcttcgagtccaggctcagcatccgc
accggctccgacatcgactgtgggaagttgcagctccgcttctccttgctgcatttcatg
gtggaggtgaagcgtgatctgactgccaaggaaatgaggctgactttgctggagctggcg
cggcgggaccacggtgctctggactgctgtgtggtggtcatcctttctcacggctgtcag
gccagccacctgcagtttccaggggctgtctacggcacagatggataccctgtgtcagtt
gagaagattgtgaacatcttcaatgggaccagctgccccagcctgggagggaagcccaag
ctctttttcatccaggcctgtggtggggagcagaaagaccatgggtttgaggtggcctcc
acttcccctcaagaggagtcccctggcagtaaccccgagtcagatgccaccccattccag
gaagatgcgtggacctttgaccaggtggacgctgtatctagtttgcccacacccagtgac
atctttgtgtcctactctactttcccaggttttgtctcatggagggagcgcaagaacggt
tcctggtatgtggagaccctggacgacatctttgagcagtgggctcactgtgaagacctg
caatcgtgctgctcagggtcgctaatgctgtttcggagaaagggatttataaacagatgc
ctggtttctttaatttcctccggaaaaaacttttttttaaaacatcataaggccagagtc
cttcatcctgccttatcttgcactccaaagccttcctgccttaggcctgaaagtggctga

DBGET integrated database retrieval system